SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980072|ref|YP_004518017.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980072|ref|YP_004518017.1|
Domain Number 1 Region: 185-235
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000353
Family HAMP domain 0.0052
Further Details:      
 
Domain Number 2 Region: 55-151
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000549
Family Sensory domain of two-component sensor kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980072|ref|YP_004518017.1|
Sequence length 302
Comment sensor [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MKNTGRRISIATKISIYFGLLISFLIITVGCSTYIRIQQIMELQIKEKGEAVASAVTALA
AERLQAGDPQLLNKLFSDLKANEDIGEAAIVNSGGKIVAHTNTLLIGRTVSGGSPEGIFQ
KSVSPGPVISAPVRTAEGSLLGYFYIQMDQERTKKYMRNLALTMVFVLLAALYAGIMLAH
IISKRVLRLPINDLMEATRHIATGNFAYKVPVRKQDELGNLAQAFNTMTVYLTNLFRTVQ
LSTMEMAKNSQLILSRTESYCSTAGKDQKEMADLAEINNAARRLARVVDRLNSLSLQFKI
TN
Download sequence
Identical sequences F6CQ07
gi|333980072|ref|YP_004518017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]