SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980349|ref|YP_004518294.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980349|ref|YP_004518294.1|
Domain Number 1 Region: 49-326
Classification Level Classification E-value
Superfamily Fe-only hydrogenase 7.19e-58
Family Fe-only hydrogenase 0.00074
Further Details:      
 
Domain Number 2 Region: 8-72
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.83e-16
Family Short-chain ferredoxins 0.06
Further Details:      
 
Domain Number 3 Region: 431-528
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000709
Family Heme-binding PAS domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333980349|ref|YP_004518294.1|
Sequence length 575
Comment PAS/PAC sensor protein [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MGEQASFPITTVADRCRDCYRCIRSCPVKAIRIEAENDKLRARIVEDLCVLCGRCVLTCP
QGAKKVSSSQERVKKLLACGDPVVASVAPSFAAMLPPGYALALPAMLKALGFALVQETSW
GAELVCRAQKQLPGDTSYVSTACPVVVNLVEKYYPELISRLAPLVSPMVAHGRWIKQNHP
QSRVVFVGPCIAKKEEARQFPDAVDEVLGFDELWQWFKEEGLSPDRFEAVDFDPPHPQRA
RLFPVEGGALHTLSLSTDMLDTRVVAISGLVNCIDFLSQLQRGEIKHPPAFMELLACNGG
CIAGPLMETAGDIFVRRQRIIEYFRARPPAAPLKGDEETKPLPLDVLRRRYRERKIYRPE
PPEEAIKQILAQTGKYTPQDELNCGACGYNSCREKAAAVYWGMAEVQMCIPYMRRRAESM
SNLVINAMPNGCIIVNRHLEILEVNPAAREMFGWQGKEITGRKLDQLLDATNFRRVLATG
EPLNVLHTYDEHDRIIREVIFPLEKGEVVVGILVDITHEKRQQEELRQMKAQTIKRAQEV
INKQMKVAQEIAGLLGETTAETKVLLSQLIRLMQE
Download sequence
Identical sequences F6CKC6
gi|333980349|ref|YP_004518294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]