SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980390|ref|YP_004518335.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980390|ref|YP_004518335.1|
Domain Number 1 Region: 5-147
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 5.63e-49
Family Ribosomal proteins L15p and L18e 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980390|ref|YP_004518335.1|
Sequence length 148
Comment 50S ribosomal protein L15 [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MAQLHDLRPNPGARTKPTRKGQGIGSGLGKTAGRGHKGQKARSGGGVRPGFEGGQMPLQR
RIPKRGFTNARFKKEIVAVNIEALNRFEDGAVVTPETLLSERIIKKLGDGVKILGDGQLE
RALTVRAHAFSKSAVEKIEAAGGKAEVI
Download sequence
Identical sequences F6CKG7
gi|333980390|ref|YP_004518335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]