SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980541|ref|YP_004518486.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980541|ref|YP_004518486.1|
Domain Number 1 Region: 154-494
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.27e-129
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000241
Further Details:      
 
Domain Number 2 Region: 13-147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-41
Family Anticodon-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333980541|ref|YP_004518486.1|
Sequence length 497
Comment lysyl-tRNA synthetase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MTEKESIELKPEDLHELLRVRLEKLEELKAQGIEPYGGRYPRTHLAAWIIDHYEECEGQK
VCIAGRLMARRGHGKASFGNLRDGSGQIQIYLRLNDVGAETYNLFQRLDIGDIIGVRGKV
FKTRTGEITVAVEELTLLAKSLRPLPEKWHGLKDVDLRYRQRYLDLIVNPEVKNTFIIRS
RVIHAIRNFLERRGFLEVETPMMHPIAGGAAARPFITHHNALDMNLYLRIAPELYLKRLL
VGGFEKVYEINRNFRNEGISTKHNPEFTMLELYQAYADYHDMMDLTEEMISTVASEVLGT
TTVTYQGVEINLAPPWKRQTMLEAVKEHTGLDFNQYRDDGERARRAARELGVEVEEKDSW
GTVLNKVFEEKVEPQLIQPVFIMDYPIEISPLAKRKTEDPALTYRFELFIYAREMANAFS
ELNDPIDQKARFLKQVEKRRAGDEEAHMMDEDYITALEYGMPPAGGLGIGIDRLVMLLTD
SPSIRDVILFPLMRPKE
Download sequence
Identical sequences F6CMG9
gi|333980541|ref|YP_004518486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]