SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980548|ref|YP_004518493.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980548|ref|YP_004518493.1|
Domain Number 1 Region: 70-273
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.6e-64
Family Biotin holoenzyme synthetase 0.000065
Further Details:      
 
Domain Number 2 Region: 6-58
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000447
Family Biotin repressor-like 0.019
Further Details:      
 
Domain Number 3 Region: 279-323
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00000000124
Family Biotin repressor (BirA) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333980548|ref|YP_004518493.1|
Sequence length 325
Comment biotin-(acetyl-CoA carboxylase) ligase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MLKEQVLEMLVKGYPDFVSGEAICQNLGVSRTAVWKHIQALRGAGYDIEAVPHAGYRLVN
IPDRLYPAEITRGLQTAFLGRNVYHYDQVESTNRTARELAARGVPDGTLVVAEEQTGGRG
RMGRGWFSPHGRGIWCSVILHPAVNPMDAPPLTMLAAVAVARALRRAAGVEAGIKWPNDL
LVGEKKICGILTELSAEMERINYLIIGMGINVNIDRHEFPPELREIATSVQIERGRRVSR
VHLLQNLLAELEYWYRIWEKEGFAPVLACWKELNVTLHRPVRVFTQRETWEGWAEDVDAD
GSLVLRLPGGEYKRVVSGEVSLRAR
Download sequence
Identical sequences F6CMH6
gi|333980548|ref|YP_004518493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]