SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980601|ref|YP_004518546.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980601|ref|YP_004518546.1|
Domain Number 1 Region: 320-613
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.53e-68
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 96-182
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000235
Family YkuI C-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333980601|ref|YP_004518546.1|
Sequence length 616
Comment methyl-accepting chemotaxis sensory transducer with Cache sensor [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MFRLRLRGKLIASFVFFSLLPLIGLALLFFRFANADLIQASFQQNRVIAEGVVSEINRFL
TDRAEMLQGLASTSDVQEMDPAKVTPLLVSLQKNISGAALLAVIDTRGYQIARSDGQKLL
YLGDREYFKEGMARRDLTISEVVINKTTGKNSVIMIAPIFTQGILKGFVQMTLDLEFLED
LIKKNKAGVAGYSFIVDRQGRAVVHPQKEKEQGEAGLIDLKDELPVKEVLRGKSGHLIYQ
TKGVKYLSNFEPVPLAGWGVVVNLPLTEATALARDFLKQVGMAVAVTVAVAVLIGLSLSN
TLTRPLKELGKSADLVSQGDLTVKIASTSRDEVGEVARAFREMVDSLAGAVKEVSNASVS
LVQAADQLKGNAEQISSGANETAAAISEVASTVNNVSSNAQMVAEISREAAEASGQGSVL
SRRIGQEIEAIHSAIREVADSIMNLDAKAGNIFHVADVIANIAEETNLLALNAAIEAARA
GEHGRGFSVVAEEVRKLAEQSAASAKEINQLVEGIRSEIGQMVKNAKENINRIEGSTQVV
SQAGESFEKISQRVEELNRYLQDVVASIQQVSASTENIAAVAEEQNAAMEEILGAANNLK
KLADQLRAMVGRFVVS
Download sequence
Identical sequences F6CMY7
gi|333980601|ref|YP_004518546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]