SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980639|ref|YP_004518584.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980639|ref|YP_004518584.1|
Domain Number 1 Region: 117-224
Classification Level Classification E-value
Superfamily Homing endonucleases 6.23e-16
Family Intein endonuclease 0.043
Further Details:      
 
Weak hits

Sequence:  gi|333980639|ref|YP_004518584.1|
Domain Number - Region: 240-309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.014
Family Extended AAA-ATPase domain 0.048
Further Details:      
 
Domain Number - Region: 26-106
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0312
Family Intein endonuclease 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980639|ref|YP_004518584.1|
Sequence length 314
Comment sporulation transcriptional regulator whiA [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MSFSTLTKNELARVVGKEKCCKLAELAALVKMDGSLSVGSEPEAALTIGTGNAAVARKIF
SLFKEIFGVHTEVLVKRKNRLRKKNLYQVRVSPPTGMTEILRRLGMADAWGQLTGGIPRE
LVRRECCRRAYLRGAFLGGGSVNNPEGTYHLEIITGNAEHARALGRLMGEFGLEARVSAR
KNWHVVYLKDSDQIVALLNIMGAHTALLDFENVRIYKDVRNQVNRLVNCETANLNKVVDA
ALRQVENIRFIAATMGLEKLPPALRQVAEARLQYPDASLRELGEILEPRVGKSGVNHRLR
RLDEIANRLRHGGE
Download sequence
Identical sequences F6CN87
gi|333980639|ref|YP_004518584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]