SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980671|ref|YP_004518616.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980671|ref|YP_004518616.1|
Domain Number 1 Region: 313-451
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-25
Family Histidine kinase 0.0054
Further Details:      
 
Domain Number 2 Region: 222-303
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000116
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 3 Region: 186-235
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000379
Family HAMP domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333980671|ref|YP_004518616.1|
Sequence length 461
Comment integral membrane sensor signal transduction histidine kinase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MKKISLTVKMWLALSLVSLLVYVIVILIMPFLVRNFFTLNMMGPQAPPEKPLEKNARREA
PPPAPPPGPPVLGRPEFRIRDFIVLEDGTTIPAEAGQMFSSSFIREILQNAVAQKASARL
YEYNRGQENIRYVIRKEQAYGRPLYRVALIRKSEEDRFIKSLLLNFLVFTGIALIISWFA
SLFIARYLTRPLIQMERHVKRIANRNWHEPLEVNRGDEIGRLARSIEVMRRQLVRQDEMQ
QSLLQNISHELKTPVMVIRSYAQAIQDGVYPRGDLAGSIQVIDEEGARLEKLVKQLLYLT
RLDYLATREQVQKEVKLNTLVENIVQRLCPQRPEISCRMDLQPVSIWGDEEVLRVMVENL
LENHLRYALSRLEISLGLSDEKKEIVLSFWNDGSRIEPHILDQLFQPFHKGREGKFGLGL
TIVQRIVKMYQGEISLKNERGGVSSTVIIPLGNIKLKPVTS
Download sequence
Identical sequences F6CNB9
gi|333980671|ref|YP_004518616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]