SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980720|ref|YP_004518665.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|333980720|ref|YP_004518665.1|
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.004
Family CopG-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980720|ref|YP_004518665.1|
Sequence length 83
Comment hypothetical protein Desku_3380 [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MKTVKLSITLPKDLVDQMKNLTTNISSFIAAGMREYVSREQSRRAIKESAGAWSDENHPE
LQTVVDVEKYVREVRSTWRRAEH
Download sequence
Identical sequences F6CNW1
gi|333980720|ref|YP_004518665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]