SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980732|ref|YP_004518677.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980732|ref|YP_004518677.1|
Domain Number 1 Region: 3-347
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 1.44e-38
Family Outer membrane efflux proteins (OEP) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980732|ref|YP_004518677.1|
Sequence length 380
Comment outer membrane efflux protein [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MPLRRILTVLTLIASLLLPSTVWAKEPATPELTLNQAIAMALAHSESVKRAEKEIDRTYA
WREERADQLDYVPTKAPGNPKVEIAWSNLLAADLTWRMSKKSLTAEQDEVALDACKKYWD
VLKAQEKVRAAEEGLKKADWELRRARANFQVGMIPQAALVAAEAQLAGAKATVEAAKNDL
DNAYASFNQLVGLWPQDRPVLVDGVNFVPLEVPDVNVEVGRIVDESPTVWLAKENVTLKK
YLEDFMFYTGEYRPYQARKIEVEQAELDAASAKKMLEEVTRSLYYNAKSLEESYQALQEG
VKTAEENLRVTKVKYDVGMATQAEVAAAEAALAEAKQKALETACQHAFIKLAFEKPWAYI
SLAVAGSGAGGSGASGNTRG
Download sequence
Identical sequences F6CNX3
gi|333980732|ref|YP_004518677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]