SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980877|ref|YP_004518822.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980877|ref|YP_004518822.1|
Domain Number 1 Region: 379-503,745-809
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.55e-48
Family Intein (protein splicing domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 178-364,804-866
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.47e-45
Family RecA protein-like (ATPase-domain) 0.054
Further Details:      
 
Domain Number 3 Region: 4-116
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 6.67e-38
Family N-terminal domain of DnaB helicase 0.0000862
Further Details:      
 
Domain Number 4 Region: 584-690
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000000014
Family Intein endonuclease 0.029
Further Details:      
 
Weak hits

Sequence:  gi|333980877|ref|YP_004518822.1|
Domain Number - Region: 488-555
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00907
Family Intein endonuclease 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333980877|ref|YP_004518822.1|
Sequence length 876
Comment replicative DNA helicase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MSEKKPPQNIDAEQSVLGALFLDREAIPRVARLLKPEDFYLEAHRKIYEAILALDEAGEP
VDLLTVTNYLQEKKLLELIGGVTYVASLVNVVPTAANVEYYARIVEEKAILRQLIEVAER
IAGLGYEGSEDVERLMDEAERMILELAARRSTGLFVSIKEILQQIFEYIEERYRNKGTIS
GIASGFTDLDRLLCGFQPGDLIIIAGRPAMGKTSLGLTIAHQVALQHQVPVAVFSLEMSR
AQLVQRMLCAEAMVDQQKVRSGYLSTEDWARLTKAAARLAKAPLYIDDTAILSPRQLRAK
ARRLQAEKGLGLILVDYLQLMQGSRRAENRQQEIAEISRSLKGVAKDLNVPVLALAQLSR
SVEQRQDKRPIMSDLRESGCLAGETLVQLASGHRVPIKDLVREKQPIKVMALNEITWKLE
PAAVSKVWCTGVKPIFRLCTQLGREVRATANHKFRTLEGWKCLGELQSGEFIALPRSLEG
LSVADPSMSASEAALLGHLLGDGCTLPRHAIQYTTKDRQLAEIVVDLINDLFKEKVFPRV
ERQRDWWQVFLASTTQLTHGTRNPVAQWMDSLGVWGYRSYEKRVPKKLFAQPPEIIAHFL
RHLWVTDGTLGVFGRKKPRAIISYATSSKQMALDIQHLLTRFGIVARVNRVPQPGKGRDQ
WHVVISGKPDIMCFIQQIGCLEAKKSRLQEILDFYSERDHITNKDVIPATVWYSIVEPAR
QLIGLSQRAMQAALGVQYCGSTLYKSNLSRTRAFRVGQIVQSEPLIRLSQSDVFWDRVVS
IEPDGIEEVYDLEVPGHHNFVAADIIVHNSLEQDADVVMFIYRDEYYRPDTEKRGIAEII
VAKQRNGPTGLVELAFLKEFTRFMNLAKEEVPGGPE
Download sequence
Identical sequences F6CKP2
gi|333980877|ref|YP_004518822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]