SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980323|ref|YP_004518268.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980323|ref|YP_004518268.1|
Domain Number 1 Region: 154-316
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.54e-30
Family Retroviral integrase, catalytic domain 0.0086
Further Details:      
 
Domain Number 2 Region: 496-717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-26
Family RecA protein-like (ATPase-domain) 0.065
Further Details:      
 
Domain Number 3 Region: 52-134
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000896
Family Paired domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333980323|ref|YP_004518268.1|
Sequence length 720
Comment Integrase catalytic subunit [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MLTDQERETIALKKFSLIAPVLNGQVQNQTEYFKNLAARPIEMPHYGPRRYSIKSFMWWL
YLYRRHGLEGLKPGYRSDRGKSRRITEEMARKIREKKAANPRLFGTLLYEELVKDGVFTP
DRLSLSTFYRFLAQNPDLAADSRPDAEEKEVKRFSHQWVNELWQTDIIYGPRLKAGRAKK
QTYLIAFIDDASRLVTAAQFCWEQNFTAVRTVLKEAILKRGIPKMIYTDNGKVYRCGQLA
MICAGLGCTLLHTEPFAPQAKGKVERFFRTVRMRFLSRLEPDRIKSLEELNLAFWQWLET
DYQRKTHSALGMSPLDYFMSQAHAVKMVSNPVFLDESFLLRVTRKINHDATFPLDNILYE
TDQQFAGTRLEVRYEPEWLGNPARPVLLYKDGLKVGEARQVDFYANAQLKRRGRGRPALK
NTATGPEDKPLTPSISEIPVPAVSFAELLKSEEAGEKWFYGLKFNPFSKEVPFDQLYLSQ
NLMELTSRLKYLQQVRGMGLVAGEPGCGKTTALRKYVEELNPAHFKPCYFTLSTVTVLEF
YKGLALTLGEQPKHKKVSLFHQIQDTITNLYYDRHITPVIVLDEIHLADGRVLEELRLLL
NFKMDSQNPFILILSGQTLIRNKLALNANSPLRQRLTVKYVMQGLKPGEIQEYCASRLKN
AGLHEEIFTPQALETIYAITKGLPRLVNNLVTSCLICAYGRKQKQIDEDVVYQASQELEV
Download sequence
Identical sequences F6CJX4
gi|333980323|ref|YP_004518268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]