SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254000443|ref|YP_003052506.1| from Methylovorus glucosetrophus SIP3-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254000443|ref|YP_003052506.1|
Domain Number 1 Region: 214-356
Classification Level Classification E-value
Superfamily CBS-domain pair 6.44e-21
Family CBS-domain pair 0.0045
Further Details:      
 
Domain Number 2 Region: 350-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.64e-16
Family CorC/HlyC domain-like 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|254000443|ref|YP_003052506.1|
Domain Number - Region: 103-164
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0143
Family Bacteriorhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254000443|ref|YP_003052506.1|
Sequence length 438
Comment hypothetical protein Msip34_2742 [Methylovorus glucosetrophus SIP3-4]
Sequence
MLTDVLLIIFAGLLVLLNGFFVAAEFGLVKLRATRVRAMAKTYGWRGRILTRVHGQLDAY
LSACQLGITLASLGLGWVGEPAFAELLTPLLQAAGIESPRIVHLVAFSLAFFIISFLHIV
VGELVPKSLAIRSAEKIGLWTAPALYGFYWVMYPAIWILNHSANLVLGVLGLQSATSHDS
HYSADELKVILRSSRADDKFSRSEWRVLAQAIDFRELDVADVMRPFHEAVVLHEGDSLEA
NLQKIVQQRYSRYPYMETSGEVIGIIHLKDLFVAQHKGRLEDIEDLVRPIAMVSPELPAT
ELFRRFQQGAPHFTVVGYEGSPPVGFVTLDNLLSALVGEIRDEFRQSLSEWTKLDDGSLL
GKASLPIPTLERTLGIDIDSNAADSVGGLILWKLGDLPEEGQKIEFDQFSIVVKKMVGPR
ILLVRVYPKFDDELGLGG
Download sequence
Identical sequences C6XBK9
WP_013443446.1.53399 WP_013443446.1.76919 582744.Msip34_2742 gi|313202402|ref|YP_004041060.1| gi|254000443|ref|YP_003052506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]