SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220933945|ref|YP_002512844.1| from Thioalkalivibrio sulfidophilus HL-EbGr7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220933945|ref|YP_002512844.1|
Domain Number 1 Region: 98-304
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 8.11e-55
Family MurCDEF 0.00000932
Further Details:      
 
Domain Number 2 Region: 306-438
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 6.18e-36
Family MurCDEF C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1-94
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 4.19e-20
Family MurE/MurF N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220933945|ref|YP_002512844.1|
Sequence length 458
Comment UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate/D-alanyl-D-alanyl ligase [Thioalkalivibrio sulfidophilus HL-EbGr7]
Sequence
MMIWSLAEIASKVGGELHGGDTVAEGVSTDTRSLQHGQLFVALTGPTYDGHAFVSDDLPA
AGVMVSRLLPTRLPQVLVDDTRLALGRLARAWRESLPVTVLALTGSNGKTTVKEMLSAIA
REHAPTLATRGNLNNDIGVPLTLLEMARNHRYAVVEMGANHHGEIAYLTSLARPDVALIT
NAGPAHLEGFGSIEGVSRAKGEIYSGLGPDGVAVINADDIYADYWYGLNPGRRVISFGLD
HVAEVSGEWQAPGSLRLHMNGRVHALELAFPGRHNALNALAAAAAALGAEIPEEAILRGL
ARVHPVSGRLVAVPGRGGALLLDDSYNANPASTRAALEVLSGHGGERCMVLGDMGELGDE
GETLHAEIGARARELGIEHFHAVGPLSAHAVRAFGEGAQHHPDQAALIEALRPMLHAGMT
VLVKGSRSARMERVVQALQADTNNNHNNGGAAHAAQSV
Download sequence
Identical sequences B8GMM5
gi|220933945|ref|YP_002512844.1| 396588.Tgr7_0765 WP_012637345.1.30883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]