SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220933947|ref|YP_002512846.1| from Thioalkalivibrio sulfidophilus HL-EbGr7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220933947|ref|YP_002512846.1|
Domain Number 1 Region: 96-300
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 9.29e-55
Family MurCDEF 0.00000253
Further Details:      
 
Domain Number 2 Region: 302-440
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.71e-47
Family MurCDEF C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 7-95
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 0.000000000000209
Family MurCD N-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220933947|ref|YP_002512846.1|
Sequence length 442
Comment UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thioalkalivibrio sulfidophilus HL-EbGr7]
Sequence
MNGMADTLIVGLGATGISVARHLRARGESFRVADSRAEPPGREELRRLAPEARLDAGPFD
PALFTGVKRLIVSPGVSVAEPAIQAARAAGAEILGDIELFAREARAPVVAITGSNGKSTV
TALVGEMARAAGLNVAVGGNFGIPALDLLNDADVELYVLELSSFQLETTESLAPVAATVL
NISADHLDRYESLEDYAAAKERIFRRTETAVINRDDPRVWSMAGGARRVSFGLDVPGEGD
WGLVERDAEPWLAQGEIPWFAESRLRIAGRHNTANALAALALGQAAGLPGEAMVEALTQF
SGLPHRCQWVTRLHGVSWYNDSKGTNLGATLAALEGFPGQVVLIAGGQGKGQDFAPLGDA
VVGKARAVVLLGEDAPHIATALDGRVPVVSVASMEAAVAEAARLAQSGDSVLLSPACASL
DMFDNYMHRGEVFMAAVRRLAP
Download sequence
Identical sequences B8GMM7
gi|220933947|ref|YP_002512846.1| WP_012637347.1.30883 396588.Tgr7_0767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]