SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220933950|ref|YP_002512849.1| from Thioalkalivibrio sulfidophilus HL-EbGr7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220933950|ref|YP_002512849.1|
Domain Number 1 Region: 98-316
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.75e-69
Family MurCDEF 0.00000121
Further Details:      
 
Domain Number 2 Region: 317-467
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.11e-48
Family MurCDEF C-terminal domain 0.00000733
Further Details:      
 
Domain Number 3 Region: 13-99
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 1.57e-29
Family MurCD N-terminal domain 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220933950|ref|YP_002512849.1|
Sequence length 475
Comment UDP-N-acetylmuramate--L-alanine ligase [Thioalkalivibrio sulfidophilus HL-EbGr7]
Sequence
MSAVTPIPMRRIRRIHFVGIGGSGMGGIAEVLANLGYQVSGSDIAENAVTRRLAGLGVTI
RLGHDAAYVQDADVLVVSSAIDPRNPELIAAREARIPVVRRAEMLAELMRFRHGIAVAGT
HGKTTTTSLVASLLAEGGLDPTFVIGGRLNSTASHSRLGQGAYLVAEADESDASFLHLQP
IIAVVTNIDADHLATYQGDFGRLRATFLEFLHHLPFYGLAVLCANDRELAGMIAEVGRPV
LTYGIGVDADVTARNVRAEGTRTHFEICLPERDDTLAVTLNLPGRHNVLNALAAVAVAHE
LGVDDAAIQQGLDKFQGIGRRFQVYGELKTAAGTVTLVDDYGHHPTEIAATLAAARDAWP
DRRLVLAFQPHRYTRTRDLFEDFAEVLSSPDALVLLDVYPAGEAAIPGADGRTLARAIRA
RGRVNPVFVDAPERFVETLKGVLRDGDVLLTQGAGNVGALAAALPAALSTEEGHP
Download sequence
Identical sequences B8GMN0
WP_012637350.1.30883 gi|220933950|ref|YP_002512849.1| 396588.Tgr7_0770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]