SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220934021|ref|YP_002512920.1| from Thioalkalivibrio sulfidophilus HL-EbGr7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220934021|ref|YP_002512920.1|
Domain Number 1 Region: 192-328
Classification Level Classification E-value
Superfamily CBS-domain pair 1.71e-25
Family CBS-domain pair 0.004
Further Details:      
 
Domain Number 2 Region: 338-417
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.74e-20
Family CorC/HlyC domain-like 0.00036
Further Details:      
 
Weak hits

Sequence:  gi|220934021|ref|YP_002512920.1|
Domain Number - Region: 10-153
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.029
Family Bacteriorhodopsin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220934021|ref|YP_002512920.1|
Sequence length 430
Comment hypothetical protein Tgr7_0842 [Thioalkalivibrio sulfidophilus HL-EbGr7]
Sequence
MAEIPLSALFAVLIALLACSAFFSGSETALMALNRYRMRHLAQAGHRGARRAQRLLDKPD
RLIGLILLGNNFVNILATQLATYIGFRLYGDVGIAIATGLLTLALLLFAEVTPKTLGALH
SERIAYPAAWVYTPLLRITYPLVWIINLIANGLLRALGVRLKDIDQHALSSDELRSVVNE
AGGLIPSKHQKMLVNILDLEKATVEDIMVPRHEIQGIDLEDDWDDIEQQLFTGSYTRMPV
YQGNIDQVLGFIHVRNVLPLIMREELSKESLRAHLRDAYFIPEGTPLNRQLLNFQRERRR
IGLVVDEYGDIQGLVTLEDLLEEIVGEFTTDPAALSPDVMPQEDGSWVVDGGVHLRELNR
MIGAHFSLEGPRTLNGLIIEHLETIPEASTSVLIDGYPIEIVQVKNNAVKTVRIGRRLAA
YRSGRTPEAD
Download sequence
Identical sequences B8GN72
WP_012637421.1.30883 gi|220934021|ref|YP_002512920.1| 396588.Tgr7_0842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]