SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220935457|ref|YP_002514356.1| from Thioalkalivibrio sulfidophilus HL-EbGr7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220935457|ref|YP_002514356.1|
Domain Number 1 Region: 61-198
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-32
Family CBS-domain pair 0.0021
Further Details:      
 
Domain Number 2 Region: 201-283
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.36e-22
Family CorC/HlyC domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220935457|ref|YP_002514356.1|
Sequence length 289
Comment Mg2+/Co2+ transporter [Thioalkalivibrio sulfidophilus HL-EbGr7]
Sequence
MNDKSRNAPPLRNWLERLSLAFTGEPRDRAQLIDLLRSAHQREILDPDALGMIEGVLQVA
EMQVRDIMVPRAQMDVVRGDGQLMDILPVITESAHSRFPVVGDSRDEVLGILLAKDLLRY
FVDGNTEDFDMRDVLRPAVFVPESKRLNVLLKEFRNSRNHMAIVVDEYGGVAGLVTIEDV
LEQIVGEIDDEHDIEDYLTHIMRHPSGRYTVKALTPIDEFNQYFSTDYSEEEFDTIGGLV
VNRFGHVPKRGDELVFDRFQVRVLRADNRRVHLLEMRLREDVEPTVDGE
Download sequence
Identical sequences B8GV23
WP_012638845.1.30883 396588.Tgr7_2289 gi|220935457|ref|YP_002514356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]