SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229589008|ref|YP_002871127.1| from Pseudomonas fluorescens SBW25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229589008|ref|YP_002871127.1|
Domain Number 1 Region: 193-423
Classification Level Classification E-value
Superfamily Colicin 1.7e-61
Family Colicin 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229589008|ref|YP_002871127.1|
Sequence length 429
Comment putative colicind-pore forming protein [Pseudomonas fluorescens SBW25]
Sequence
MSTTNGIELPPIIVTPDPPPLPPVPVVVPGVPGAQPPNSVDVPVGTDVETLLSLPGIRSS
SDYVLPIAGKAARAQVDIETAYNANFPNIPTQTESEVAAALGDVGLLSELEKAQKEKAVV
DGLVAQAQELLVNSNAVANSYFGRDPLAVEFKKNSAILATDIVNGKRPGTPIEIYQSFIA
SISAVYESKKLAEKIRILTEKSNALTLAVAAAQAAEDERIAAEAAAKKAAEEAEAKRIAE
EQAKAEEEIKGAIKFTADFYKEIGEKYGAQMSALATDLAETAKGKTLRSAEEALKAFDQY
KDHLDKKFSAADRAAIVNALDSLDRAELAKNLNLFAKGFGYASKAFDVYDLVEEVKKSYA
SGDWNNTVLKMETLFAGSAATGLIAFAFGVTVSTPIGIVAFALIMALVSAYIDDAHVKQF
NDALDAMLP
Download sequence
Identical sequences C3K4R4
WP_012722778.1.23922 216595.PFLU1482 gi|229589008|ref|YP_002871127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]