SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226222848|ref|YP_002756955.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226222848|ref|YP_002756955.1|
Domain Number 1 Region: 455-646
Classification Level Classification E-value
Superfamily PRTase-like 1.97e-60
Family Phosphoribosyltransferases (PRTases) 0.00000334
Further Details:      
 
Domain Number 2 Region: 9-238
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.09e-59
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 3 Region: 368-444
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.013
Further Details:      
 
Domain Number 4 Region: 217-326
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000523
Family MesJ substrate recognition domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226222848|ref|YP_002756955.1|
Sequence length 648
Comment hypothetical protein Lm4b_00217 [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MDDTDKRVHKYIEKHDLIRSDDKLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHINHH
LRENAANEQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEETARIVRYDFFEKVMAEK
KINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDY
AQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEAL
ASDLLKKNLIKNGKRTTLLLTNFKNEANPLQRRAIHLLLRYLYNEDASFITVNHIYQIIQ
MIQSDNPSSSIDLPNKLVANRAYDKLHFQFGEREAPSEFYHQLELNDRIELDNKASIRLK
LKSSVVQTNGLNGMLLDAEEITLPLIVRNRVNGDRMTMKGQAGSKKLKDIFIDAKIPRQE
RDKLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYIIRYTRNIGGNESMHNDIQKVLIS
EDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFMTDLLKRVDTYLEMDFMDVSSYGN
GTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTLSYLVDLIKYRKAKSVKLVTLLDKP
AGRNVEIEADYVGFVVPNEFVVGYGLDYAERYRNLPYIGILKPEIYSE
Download sequence
Identical sequences A0A149X6Y2 A0A241SLW7 A0A2C9PME4
WP_003725743.1.100142 WP_003725743.1.100261 WP_003725743.1.10039 WP_003725743.1.100522 WP_003725743.1.10073 WP_003725743.1.101093 WP_003725743.1.101318 WP_003725743.1.101527 WP_003725743.1.101688 WP_003725743.1.10176 WP_003725743.1.101811 WP_003725743.1.102145 WP_003725743.1.10418 WP_003725743.1.10460 WP_003725743.1.1146 WP_003725743.1.11788 WP_003725743.1.12028 WP_003725743.1.12142 WP_003725743.1.12148 WP_003725743.1.12278 WP_003725743.1.12287 WP_003725743.1.13180 WP_003725743.1.13847 WP_003725743.1.14072 WP_003725743.1.14339 WP_003725743.1.14641 WP_003725743.1.14895 WP_003725743.1.15340 WP_003725743.1.15342 WP_003725743.1.15495 WP_003725743.1.15518 WP_003725743.1.15564 WP_003725743.1.15618 WP_003725743.1.15619 WP_003725743.1.15659 WP_003725743.1.1575 WP_003725743.1.15847 WP_003725743.1.16631 WP_003725743.1.16726 WP_003725743.1.16746 WP_003725743.1.17131 WP_003725743.1.17399 WP_003725743.1.17774 WP_003725743.1.18463 WP_003725743.1.18677 WP_003725743.1.18721 WP_003725743.1.18833 WP_003725743.1.19167 WP_003725743.1.19195 WP_003725743.1.19372 WP_003725743.1.19542 WP_003725743.1.19615 WP_003725743.1.19901 WP_003725743.1.20378 WP_003725743.1.20548 WP_003725743.1.21338 WP_003725743.1.21371 WP_003725743.1.21428 WP_003725743.1.21429 WP_003725743.1.21527 WP_003725743.1.21529 WP_003725743.1.21567 WP_003725743.1.22099 WP_003725743.1.22194 WP_003725743.1.22597 WP_003725743.1.23139 WP_003725743.1.23291 WP_003725743.1.23433 WP_003725743.1.24048 WP_003725743.1.24335 WP_003725743.1.24411 WP_003725743.1.24531 WP_003725743.1.24867 WP_003725743.1.24975 WP_003725743.1.2545 WP_003725743.1.25456 WP_003725743.1.25500 WP_003725743.1.25616 WP_003725743.1.25805 WP_003725743.1.26634 WP_003725743.1.26957 WP_003725743.1.27056 WP_003725743.1.27143 WP_003725743.1.27517 WP_003725743.1.27669 WP_003725743.1.27948 WP_003725743.1.28098 WP_003725743.1.2824 WP_003725743.1.28260 WP_003725743.1.2855 WP_003725743.1.28722 WP_003725743.1.28804 WP_003725743.1.29309 WP_003725743.1.29565 WP_003725743.1.30124 WP_003725743.1.30273 WP_003725743.1.30372 WP_003725743.1.30660 WP_003725743.1.30837 WP_003725743.1.30851 WP_003725743.1.3103 WP_003725743.1.31289 WP_003725743.1.31966 WP_003725743.1.3206 WP_003725743.1.32240 WP_003725743.1.32648 WP_003725743.1.32817 WP_003725743.1.33016 WP_003725743.1.3314 WP_003725743.1.33591 WP_003725743.1.34369 WP_003725743.1.34790 WP_003725743.1.34911 WP_003725743.1.3511 WP_003725743.1.35514 WP_003725743.1.35738 WP_003725743.1.35979 WP_003725743.1.36115 WP_003725743.1.37023 WP_003725743.1.37665 WP_003725743.1.38015 WP_003725743.1.38302 WP_003725743.1.38382 WP_003725743.1.38396 WP_003725743.1.384 WP_003725743.1.38528 WP_003725743.1.38575 WP_003725743.1.39000 WP_003725743.1.39218 WP_003725743.1.39307 WP_003725743.1.39316 WP_003725743.1.39794 WP_003725743.1.39871 WP_003725743.1.40245 WP_003725743.1.404 WP_003725743.1.40580 WP_003725743.1.40841 WP_003725743.1.40978 WP_003725743.1.41023 WP_003725743.1.41700 WP_003725743.1.41970 WP_003725743.1.42040 WP_003725743.1.42310 WP_003725743.1.42339 WP_003725743.1.42550 WP_003725743.1.42564 WP_003725743.1.42926 WP_003725743.1.43135 WP_003725743.1.43304 WP_003725743.1.43336 WP_003725743.1.43458 WP_003725743.1.43480 WP_003725743.1.43768 WP_003725743.1.44230 WP_003725743.1.44596 WP_003725743.1.44703 WP_003725743.1.4472 WP_003725743.1.4503 WP_003725743.1.45355 WP_003725743.1.45541 WP_003725743.1.4562 WP_003725743.1.45719 WP_003725743.1.4578 WP_003725743.1.45883 WP_003725743.1.46180 WP_003725743.1.46277 WP_003725743.1.46425 WP_003725743.1.46456 WP_003725743.1.46711 WP_003725743.1.46834 WP_003725743.1.46981 WP_003725743.1.47518 WP_003725743.1.47520 WP_003725743.1.4753 WP_003725743.1.47650 WP_003725743.1.47759 WP_003725743.1.47952 WP_003725743.1.48161 WP_003725743.1.48235 WP_003725743.1.48440 WP_003725743.1.48441 WP_003725743.1.49391 WP_003725743.1.49507 WP_003725743.1.4974 WP_003725743.1.49754 WP_003725743.1.50044 WP_003725743.1.50073 WP_003725743.1.50293 WP_003725743.1.50662 WP_003725743.1.50775 WP_003725743.1.50862 WP_003725743.1.51086 WP_003725743.1.51262 WP_003725743.1.51384 WP_003725743.1.51768 WP_003725743.1.52142 WP_003725743.1.52371 WP_003725743.1.52420 WP_003725743.1.52507 WP_003725743.1.52782 WP_003725743.1.52829 WP_003725743.1.53051 WP_003725743.1.53193 WP_003725743.1.53426 WP_003725743.1.53536 WP_003725743.1.53603 WP_003725743.1.53877 WP_003725743.1.54434 WP_003725743.1.54505 WP_003725743.1.54508 WP_003725743.1.54740 WP_003725743.1.5514 WP_003725743.1.55423 WP_003725743.1.55494 WP_003725743.1.55850 WP_003725743.1.56344 WP_003725743.1.56566 WP_003725743.1.56748 WP_003725743.1.5687 WP_003725743.1.57106 WP_003725743.1.57228 WP_003725743.1.57913 WP_003725743.1.57932 WP_003725743.1.58083 WP_003725743.1.58491 WP_003725743.1.59113 WP_003725743.1.59353 WP_003725743.1.59652 WP_003725743.1.59720 WP_003725743.1.60162 WP_003725743.1.60295 WP_003725743.1.60768 WP_003725743.1.61072 WP_003725743.1.611 WP_003725743.1.61371 WP_003725743.1.6236 WP_003725743.1.62375 WP_003725743.1.62494 WP_003725743.1.62874 WP_003725743.1.63269 WP_003725743.1.63283 WP_003725743.1.63315 WP_003725743.1.63605 WP_003725743.1.63842 WP_003725743.1.63883 WP_003725743.1.64147 WP_003725743.1.64413 WP_003725743.1.65143 WP_003725743.1.65392 WP_003725743.1.65561 WP_003725743.1.66134 WP_003725743.1.66138 WP_003725743.1.66545 WP_003725743.1.66596 WP_003725743.1.66993 WP_003725743.1.6745 WP_003725743.1.67551 WP_003725743.1.67654 WP_003725743.1.67926 WP_003725743.1.68128 WP_003725743.1.68208 WP_003725743.1.68236 WP_003725743.1.68282 WP_003725743.1.68497 WP_003725743.1.68525 WP_003725743.1.69263 WP_003725743.1.69603 WP_003725743.1.69864 WP_003725743.1.6991 WP_003725743.1.69989 WP_003725743.1.70122 WP_003725743.1.7026 WP_003725743.1.70590 WP_003725743.1.71381 WP_003725743.1.71437 WP_003725743.1.71726 WP_003725743.1.71763 WP_003725743.1.71858 WP_003725743.1.72264 WP_003725743.1.72370 WP_003725743.1.72886 WP_003725743.1.72918 WP_003725743.1.73448 WP_003725743.1.73508 WP_003725743.1.73545 WP_003725743.1.73613 WP_003725743.1.74095 WP_003725743.1.74436 WP_003725743.1.74927 WP_003725743.1.74956 WP_003725743.1.7504 WP_003725743.1.75072 WP_003725743.1.75196 WP_003725743.1.7528 WP_003725743.1.7553 WP_003725743.1.75548 WP_003725743.1.7565 WP_003725743.1.75838 WP_003725743.1.75869 WP_003725743.1.75923 WP_003725743.1.76094 WP_003725743.1.76247 WP_003725743.1.76254 WP_003725743.1.76367 WP_003725743.1.76545 WP_003725743.1.76608 WP_003725743.1.7718 WP_003725743.1.77191 WP_003725743.1.77222 WP_003725743.1.77345 WP_003725743.1.77697 WP_003725743.1.77928 WP_003725743.1.78130 WP_003725743.1.78315 WP_003725743.1.78681 WP_003725743.1.79128 WP_003725743.1.79149 WP_003725743.1.79259 WP_003725743.1.79602 WP_003725743.1.80514 WP_003725743.1.81140 WP_003725743.1.81476 WP_003725743.1.81495 WP_003725743.1.82372 WP_003725743.1.82480 WP_003725743.1.82821 WP_003725743.1.83015 WP_003725743.1.83130 WP_003725743.1.83217 WP_003725743.1.83809 WP_003725743.1.83907 WP_003725743.1.84180 WP_003725743.1.8465 WP_003725743.1.85036 WP_003725743.1.85194 WP_003725743.1.8539 WP_003725743.1.85576 WP_003725743.1.85690 WP_003725743.1.85890 WP_003725743.1.86056 WP_003725743.1.86098 WP_003725743.1.86232 WP_003725743.1.86279 WP_003725743.1.86683 WP_003725743.1.86752 WP_003725743.1.87179 WP_003725743.1.87328 WP_003725743.1.87329 WP_003725743.1.87436 WP_003725743.1.87537 WP_003725743.1.87890 WP_003725743.1.88397 WP_003725743.1.88422 WP_003725743.1.88768 WP_003725743.1.88806 WP_003725743.1.88877 WP_003725743.1.88895 WP_003725743.1.88974 WP_003725743.1.89014 WP_003725743.1.89267 WP_003725743.1.89387 WP_003725743.1.89505 WP_003725743.1.89897 WP_003725743.1.89916 WP_003725743.1.89969 WP_003725743.1.90212 WP_003725743.1.90459 WP_003725743.1.90741 WP_003725743.1.90963 WP_003725743.1.91140 WP_003725743.1.91195 WP_003725743.1.91443 WP_003725743.1.91560 WP_003725743.1.91922 WP_003725743.1.9243 WP_003725743.1.92494 WP_003725743.1.92591 WP_003725743.1.92963 WP_003725743.1.93325 WP_003725743.1.93490 WP_003725743.1.94059 WP_003725743.1.94206 WP_003725743.1.94233 WP_003725743.1.94336 WP_003725743.1.94401 WP_003725743.1.94431 WP_003725743.1.94447 WP_003725743.1.94537 WP_003725743.1.94906 WP_003725743.1.9502 WP_003725743.1.9505 WP_003725743.1.95100 WP_003725743.1.95197 WP_003725743.1.95696 WP_003725743.1.96084 WP_003725743.1.96156 WP_003725743.1.96422 WP_003725743.1.96449 WP_003725743.1.96496 WP_003725743.1.96596 WP_003725743.1.96708 WP_003725743.1.96835 WP_003725743.1.96867 WP_003725743.1.97469 WP_003725743.1.97589 WP_003725743.1.9768 WP_003725743.1.97900 WP_003725743.1.98490 WP_003725743.1.98826 WP_003725743.1.98974 WP_003725743.1.99518 WP_003725743.1.99553 WP_003725743.1.99702 WP_003725743.1.99836 WP_003725743.1.99906 gi|406702991|ref|YP_006753345.1| 634178.Lm4b_00217 gi|405748561|ref|YP_006672027.1| gi|525723810|ref|YP_008286483.1| gi|525735782|ref|YP_008291397.1| gi|226222848|ref|YP_002756955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]