SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226223822|ref|YP_002757929.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226223822|ref|YP_002757929.1|
Domain Number 1 Region: 209-406
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.85e-61
Family B3/B4 domain of PheRS, PheT 0.0000144
Further Details:      
 
Domain Number 2 Region: 475-696
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.79e-51
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000652
Further Details:      
 
Domain Number 3 Region: 36-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.63e-43
Family Myf domain 0.0077
Further Details:      
 
Domain Number 4 Region: 704-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.19e-30
Family Anticodon-binding domain of PheRS 0.00048
Further Details:      
 
Domain Number 5 Region: 412-483
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.49e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226223822|ref|YP_002757929.1|
Sequence length 802
Comment phenylalanyl-tRNA synthetase beta subunit [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MLVSYNWVKEFFQDFPLTAEELGEAITRTGIEIEGVEELSASLKNVVVGEVLSCERHPDA
EKLNKCLVQTDEVEPVQIICGAPNVAAGQKVIVAKVGARLPGGLKIKRAKLRGEVSEGMI
CSLAELGFESKVVPKAYAEGIYVLPAHVETGVSAITLLGLDDAILDMAITPNRADALSMN
GVAHEVGAIIHQKPAQPTEPDVSEKGKADDFISVEVENPAETPYYAIKMVENIEIKESPL
WLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIGSKKIVVRSAKEQEEITTLD
GEKRTLQAGHTVITNGVEPIAIAGVMGGEFSEVTENTTTVALEGAIFSSSSIGKASRELY
LRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVGGVVEVDNREKAVNKIETSLTR
INRILGTAITLAEIETIFDRLGFVLEVKNDTLIIEVPTRRWDITIEADILEEVARIYGYD
EIPVTLPATSTTGGLSDSQKARRVMRAYLEGAGLNQALTYSLTSKKDATRLALSDEKTVA
LSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVALYEMGTVFYATEGDNLPIEQEHLA
GLITGNWHTVDWQKTPKPVDFFVLKGIVEGLVNKLGIKSELHWKQTEKEELHPGRTASLI
LEGQEIGYLGALHPAVEANYDLKETYVFEINVAALLDATKEKVVYHPIPRYPEMTRDLAL
LVDKNTDHATISQVIQEHGGKLLVDIELFDIFEGESLGENKKSLAYTLTFLDSERTLVEE
DVQKATNKVIEALQEKLHAIIR
Download sequence
Identical sequences WP_012681262.1.13329 WP_012681262.1.15659 WP_012681262.1.16726 WP_012681262.1.18463 WP_012681262.1.20378 WP_012681262.1.21429 WP_012681262.1.22194 WP_012681262.1.22468 WP_012681262.1.26634 WP_012681262.1.27681 WP_012681262.1.28098 WP_012681262.1.34911 WP_012681262.1.37426 WP_012681262.1.4642 WP_012681262.1.46711 WP_012681262.1.46981 WP_012681262.1.47518 WP_012681262.1.51980 WP_012681262.1.53603 WP_012681262.1.53870 WP_012681262.1.5538 WP_012681262.1.58516 WP_012681262.1.61824 WP_012681262.1.65392 WP_012681262.1.68497 WP_012681262.1.70373 WP_012681262.1.74956 WP_012681262.1.76168 WP_012681262.1.79259 WP_012681262.1.88768 WP_012681262.1.90741 WP_012681262.1.92963 WP_012681262.1.97589 WP_012681262.1.99553 WP_012681262.1.99702 WP_012681262.1.99906 gi|406703984|ref|YP_006754338.1| gi|226223822|ref|YP_002757929.1| 634178.Lm4b_01227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]