SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226224004|ref|YP_002758111.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226224004|ref|YP_002758111.1|
Domain Number 1 Region: 257-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.96e-91
Family DNA repair protein MutS, domain III 0.000000609
Further Details:      
 
Domain Number 2 Region: 559-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-63
Family ABC transporter ATPase domain-like 0.000000846
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.62e-42
Family DNA repair protein MutS, domain I 0.0000285
Further Details:      
 
Domain Number 4 Region: 114-269
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 9.02e-32
Family DNA repair protein MutS, domain II 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226224004|ref|YP_002758111.1|
Sequence length 860
Comment DNA mismatch repair (recognition) [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MTEYTPMIKQYLEIKDKYQDAFLFFRLGDFYEMFFEDALNASQILEITLTGREGGTKEKI
PMCGVPYHSASGYIDTLIEKGYKVAICEQVEDPKTTKGMVKREVVQLISPGTVMDERGLK
AKENNYIASLYCYEGKEYGFAYSDLSTGELKSTVIEASEDRLINELTTLSTRELIVSSSE
KEVLSDVMKEQLGLTFSVHEEDTIPVENEKLVTRHMSLSEKRAIGKLLHYLKETQKRDLG
HLQQAVHYETSNYMKMDYYSKRNLELAESIRGKGRQGTLLWLLDNTQTAMGGRMLKQWID
RPLIDRKKIIDRQNDVSELMAHFFERLELVENLKNVYDLERLAGRVAYGNVNARDLIQLR
NSLYQIPRIRATLLSMSSESLTELANQLDPCEELTEKLEEAIMDSAPISIREGGIIKDGY
NSQLDTYRDASRNGKTWIAELERKERELTGIKTMKVGFNRVFGYYIEVTRANTHLLPEGR
YERKQTLTNAERYITPELKEKEKLILDAEEKSMELEYQLFSEVREMVKDYIERLQKLAKS
VSEIDCLQSFADISEKNHFIRPTLSEDGSLHVKQGRHPVVEKVMGAQSYVANDCVLDENR
EILLITGPNMSGKSTYMRQVALTAICAQVGCFVPAEEAILPIFDQIFTRIGAADDLIAGQ
STFMVEMLEARNAIVHATKDSLILFDEIGRGTATYDGMALAQAIIEYIHENVHAKTLFST
HYHELTDLEKELSGLQNIHVSAVEENGKVVFLHKIKEGPADKSYGIHVAELAELPKSLIE
RASRILEQLENDDKKIIIASVKQPEEVHEEVQLSMFPVEPEKKASSKETKLLKEIASMNI
MQMTPMDAMNKLYELQSKIH
Download sequence
Identical sequences C1L2V9
gi|226224004|ref|YP_002758111.1| 634178.Lm4b_01412 WP_012681287.1.1146 WP_012681287.1.12028 WP_012681287.1.14103 WP_012681287.1.20378 WP_012681287.1.21542 WP_012681287.1.22194 WP_012681287.1.26634 WP_012681287.1.28098 WP_012681287.1.34911 WP_012681287.1.46981 WP_012681287.1.47518 WP_012681287.1.53603 WP_012681287.1.59720 WP_012681287.1.65392 WP_012681287.1.68497 WP_012681287.1.79259 WP_012681287.1.85576 WP_012681287.1.88768 WP_012681287.1.90741 WP_012681287.1.92963 WP_012681287.1.93325 WP_012681287.1.94431 WP_012681287.1.97589 WP_012681287.1.99553 WP_012681287.1.99663 WP_012681287.1.99702 gi|406704176|ref|YP_006754530.1| gi|386732142|ref|YP_006205638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]