SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226224158|ref|YP_002758265.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226224158|ref|YP_002758265.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.15e-43
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 162-313
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.66e-27
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00083
Further Details:      
 
Domain Number 3 Region: 319-419
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.000000000000876
Family Glutamyl tRNA-reductase dimerization domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226224158|ref|YP_002758265.1|
Sequence length 435
Comment glutamyl-tRNA reductase [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MFILTMGLNHHTAPIDIREKLVFKESEEEMALVTLQQEKSILENVIISTCNRTEIIAVVD
QIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEESDAVNHLYKVTAGLDSLVLGETQILGQ
VKHAFEIAKQTATTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSL
DNKKIVLVGAGEMSELALQNLAGSGIADITIINRTKSNAELLANQFQAKVGAYENMNEHL
MLADIVLVSTSAAEPIIKQAAMQDLMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDID
DLAGVVSANSLERQRIVLELEKTIEAEVRNFFEWEKQLGVVPVIRALREKALDMQEVTMT
SLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEEDATTSIEHFKRIFGLSE
TDVTVIEKEQAETRS
Download sequence
Identical sequences C1KVK4
gi|386732295|ref|YP_006205791.1| gi|226224158|ref|YP_002758265.1| gi|406704332|ref|YP_006754686.1| 634178.Lm4b_01568 WP_012681306.1.100221 WP_012681306.1.1146 WP_012681306.1.13329 WP_012681306.1.15618 WP_012681306.1.20378 WP_012681306.1.21429 WP_012681306.1.22194 WP_012681306.1.22468 WP_012681306.1.24115 WP_012681306.1.24975 WP_012681306.1.25746 WP_012681306.1.26170 WP_012681306.1.26634 WP_012681306.1.28098 WP_012681306.1.34911 WP_012681306.1.43135 WP_012681306.1.44161 WP_012681306.1.45883 WP_012681306.1.4642 WP_012681306.1.46725 WP_012681306.1.46981 WP_012681306.1.47518 WP_012681306.1.51980 WP_012681306.1.53603 WP_012681306.1.53870 WP_012681306.1.5538 WP_012681306.1.57913 WP_012681306.1.58 WP_012681306.1.58516 WP_012681306.1.59720 WP_012681306.1.61824 WP_012681306.1.65392 WP_012681306.1.66993 WP_012681306.1.68497 WP_012681306.1.6991 WP_012681306.1.70373 WP_012681306.1.73448 WP_012681306.1.73613 WP_012681306.1.79259 WP_012681306.1.85576 WP_012681306.1.87903 WP_012681306.1.88768 WP_012681306.1.90741 WP_012681306.1.92963 WP_012681306.1.93014 WP_012681306.1.93325 WP_012681306.1.94431 WP_012681306.1.97589 WP_012681306.1.99553 WP_012681306.1.99702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]