SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226224423|ref|YP_002758530.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226224423|ref|YP_002758530.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-83
Family Protein kinases, catalytic subunit 0.000000998
Further Details:      
 
Weak hits

Sequence:  gi|226224423|ref|YP_002758530.1|
Domain Number - Region: 506-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000123
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0079
Further Details:      
 
Domain Number - Region: 367-428
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00785
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226224423|ref|YP_002758530.1|
Sequence length 655
Comment serine/threonine-specific protein kinase [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYDKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARAQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNQDRLNEPKYIFPTDDGDTKAIPIIATKD
TMQNLDKTIVPEGKVAAAEVAPEENKGKKKKKMSKKKKIALIVSSVIIIFIIGILLLWLL
GKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNSDEVAEGKVINTDPEAGEMKEK
GTKINLFVSIGSKKITMDDYTGRSYTDTKALLEEQGFNNISSEEAYSSEVEKGLIISQTP
TQGTDVVAKSTDVKFVVSKGAEPISLKDLRGYTKTAVEDYASPLGLKVSSKEENSNTVEK
GQVISQSPSAGTAMNPGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKIQIY
IQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSAGYKIISDDKVIDEGTVPYPN
Download sequence
Identical sequences A0A241SR76 A0A2A5ZM05
gi|525723026|ref|YP_008287734.1| gi|386732560|ref|YP_006206056.1| gi|404281433|ref|YP_006682331.1| gi|405755981|ref|YP_006679445.1| 634178.Lm4b_01836 gi|525734200|ref|YP_008290070.1| gi|226224423|ref|YP_002758530.1| gi|406704604|ref|YP_006754958.1| gi|404287249|ref|YP_006693835.1| WP_003725653.1.100078 WP_003725653.1.100142 WP_003725653.1.100160 WP_003725653.1.100221 WP_003725653.1.100261 WP_003725653.1.10039 WP_003725653.1.100458 WP_003725653.1.100522 WP_003725653.1.101057 WP_003725653.1.101093 WP_003725653.1.101318 WP_003725653.1.101527 WP_003725653.1.101529 WP_003725653.1.101688 WP_003725653.1.10176 WP_003725653.1.101772 WP_003725653.1.101811 WP_003725653.1.10182 WP_003725653.1.102145 WP_003725653.1.10418 WP_003725653.1.10444 WP_003725653.1.10460 WP_003725653.1.11086 WP_003725653.1.1146 WP_003725653.1.1160 WP_003725653.1.11788 WP_003725653.1.12142 WP_003725653.1.12148 WP_003725653.1.12278 WP_003725653.1.12287 WP_003725653.1.12417 WP_003725653.1.12544 WP_003725653.1.13180 WP_003725653.1.13684 WP_003725653.1.13779 WP_003725653.1.13847 WP_003725653.1.13921 WP_003725653.1.14072 WP_003725653.1.14103 WP_003725653.1.14339 WP_003725653.1.14636 WP_003725653.1.14641 WP_003725653.1.14832 WP_003725653.1.14895 WP_003725653.1.15085 WP_003725653.1.15122 WP_003725653.1.15340 WP_003725653.1.15342 WP_003725653.1.15495 WP_003725653.1.155 WP_003725653.1.15518 WP_003725653.1.15564 WP_003725653.1.15618 WP_003725653.1.15619 WP_003725653.1.15659 WP_003725653.1.1575 WP_003725653.1.15847 WP_003725653.1.16403 WP_003725653.1.16631 WP_003725653.1.1667 WP_003725653.1.16726 WP_003725653.1.16746 WP_003725653.1.17131 WP_003725653.1.17398 WP_003725653.1.17399 WP_003725653.1.17774 WP_003725653.1.18026 WP_003725653.1.18046 WP_003725653.1.18463 WP_003725653.1.18677 WP_003725653.1.18721 WP_003725653.1.18833 WP_003725653.1.19167 WP_003725653.1.19195 WP_003725653.1.1929 WP_003725653.1.19372 WP_003725653.1.19443 WP_003725653.1.19542 WP_003725653.1.19549 WP_003725653.1.19607 WP_003725653.1.19615 WP_003725653.1.19685 WP_003725653.1.197 WP_003725653.1.19901 WP_003725653.1.20548 WP_003725653.1.21099 WP_003725653.1.21338 WP_003725653.1.21371 WP_003725653.1.21428 WP_003725653.1.21429 WP_003725653.1.21527 WP_003725653.1.21529 WP_003725653.1.21542 WP_003725653.1.21567 WP_003725653.1.21597 WP_003725653.1.21706 WP_003725653.1.21711 WP_003725653.1.21889 WP_003725653.1.22099 WP_003725653.1.22194 WP_003725653.1.22597 WP_003725653.1.22776 WP_003725653.1.23060 WP_003725653.1.23139 WP_003725653.1.23255 WP_003725653.1.23291 WP_003725653.1.23425 WP_003725653.1.23433 WP_003725653.1.23448 WP_003725653.1.23650 WP_003725653.1.23848 WP_003725653.1.24048 WP_003725653.1.24075 WP_003725653.1.24115 WP_003725653.1.24335 WP_003725653.1.24411 WP_003725653.1.24422 WP_003725653.1.24531 WP_003725653.1.24667 WP_003725653.1.24867 WP_003725653.1.24975 WP_003725653.1.2545 WP_003725653.1.25456 WP_003725653.1.25471 WP_003725653.1.25500 WP_003725653.1.25616 WP_003725653.1.25746 WP_003725653.1.25805 WP_003725653.1.25830 WP_003725653.1.26170 WP_003725653.1.26322 WP_003725653.1.26634 WP_003725653.1.2666 WP_003725653.1.26957 WP_003725653.1.27056 WP_003725653.1.27132 WP_003725653.1.27143 WP_003725653.1.27517 WP_003725653.1.27669 WP_003725653.1.27681 WP_003725653.1.27728 WP_003725653.1.27826 WP_003725653.1.27891 WP_003725653.1.27948 WP_003725653.1.28060 WP_003725653.1.28098 WP_003725653.1.2824 WP_003725653.1.28260 WP_003725653.1.28369 WP_003725653.1.2855 WP_003725653.1.28722 WP_003725653.1.28792 WP_003725653.1.28804 WP_003725653.1.29309 WP_003725653.1.29565 WP_003725653.1.29803 WP_003725653.1.30124 WP_003725653.1.30273 WP_003725653.1.30372 WP_003725653.1.30430 WP_003725653.1.30660 WP_003725653.1.30837 WP_003725653.1.30851 WP_003725653.1.3103 WP_003725653.1.31062 WP_003725653.1.31289 WP_003725653.1.31305 WP_003725653.1.31691 WP_003725653.1.31966 WP_003725653.1.3206 WP_003725653.1.32240 WP_003725653.1.32648 WP_003725653.1.32681 WP_003725653.1.32698 WP_003725653.1.32767 WP_003725653.1.32817 WP_003725653.1.33016 WP_003725653.1.3314 WP_003725653.1.33282 WP_003725653.1.33591 WP_003725653.1.3393 WP_003725653.1.34369 WP_003725653.1.34698 WP_003725653.1.34714 WP_003725653.1.34790 WP_003725653.1.34911 WP_003725653.1.3511 WP_003725653.1.35350 WP_003725653.1.35514 WP_003725653.1.35738 WP_003725653.1.35979 WP_003725653.1.36115 WP_003725653.1.3613 WP_003725653.1.37023 WP_003725653.1.37426 WP_003725653.1.37471 WP_003725653.1.37665 WP_003725653.1.37927 WP_003725653.1.37986 WP_003725653.1.38015 WP_003725653.1.38302 WP_003725653.1.38382 WP_003725653.1.38396 WP_003725653.1.384 WP_003725653.1.38424 WP_003725653.1.38528 WP_003725653.1.38575 WP_003725653.1.38741 WP_003725653.1.38819 WP_003725653.1.3892 WP_003725653.1.39000 WP_003725653.1.39218 WP_003725653.1.39307 WP_003725653.1.39316 WP_003725653.1.39348 WP_003725653.1.39427 WP_003725653.1.39794 WP_003725653.1.39871 WP_003725653.1.40245 WP_003725653.1.404 WP_003725653.1.40420 WP_003725653.1.40580 WP_003725653.1.40841 WP_003725653.1.40978 WP_003725653.1.41023 WP_003725653.1.41337 WP_003725653.1.4166 WP_003725653.1.41700 WP_003725653.1.41876 WP_003725653.1.41970 WP_003725653.1.42040 WP_003725653.1.42089 WP_003725653.1.42310 WP_003725653.1.42317 WP_003725653.1.42339 WP_003725653.1.42550 WP_003725653.1.42564 WP_003725653.1.42926 WP_003725653.1.43060 WP_003725653.1.43135 WP_003725653.1.43304 WP_003725653.1.43336 WP_003725653.1.43350 WP_003725653.1.43458 WP_003725653.1.43480 WP_003725653.1.43768 WP_003725653.1.43807 WP_003725653.1.44161 WP_003725653.1.44230 WP_003725653.1.44427 WP_003725653.1.44596 WP_003725653.1.44663 WP_003725653.1.44703 WP_003725653.1.4472 WP_003725653.1.44806 WP_003725653.1.4503 WP_003725653.1.45355 WP_003725653.1.45541 WP_003725653.1.4562 WP_003725653.1.45719 WP_003725653.1.4578 WP_003725653.1.45883 WP_003725653.1.46154 WP_003725653.1.46180 WP_003725653.1.46277 WP_003725653.1.46425 WP_003725653.1.46456 WP_003725653.1.46711 WP_003725653.1.46725 WP_003725653.1.46834 WP_003725653.1.46867 WP_003725653.1.46981 WP_003725653.1.47384 WP_003725653.1.47431 WP_003725653.1.47518 WP_003725653.1.47520 WP_003725653.1.4753 WP_003725653.1.47650 WP_003725653.1.47759 WP_003725653.1.47952 WP_003725653.1.47979 WP_003725653.1.48161 WP_003725653.1.48163 WP_003725653.1.48235 WP_003725653.1.48410 WP_003725653.1.48440 WP_003725653.1.48441 WP_003725653.1.48565 WP_003725653.1.49 WP_003725653.1.49390 WP_003725653.1.49391 WP_003725653.1.49507 WP_003725653.1.49708 WP_003725653.1.4974 WP_003725653.1.49754 WP_003725653.1.50044 WP_003725653.1.50063 WP_003725653.1.50073 WP_003725653.1.50288 WP_003725653.1.50293 WP_003725653.1.50482 WP_003725653.1.50662 WP_003725653.1.50765 WP_003725653.1.50775 WP_003725653.1.50862 WP_003725653.1.51086 WP_003725653.1.51262 WP_003725653.1.51384 WP_003725653.1.5170 WP_003725653.1.51768 WP_003725653.1.52142 WP_003725653.1.52290 WP_003725653.1.52371 WP_003725653.1.52420 WP_003725653.1.52507 WP_003725653.1.52725 WP_003725653.1.52782 WP_003725653.1.52829 WP_003725653.1.53051 WP_003725653.1.53193 WP_003725653.1.53426 WP_003725653.1.53536 WP_003725653.1.53603 WP_003725653.1.53877 WP_003725653.1.54281 WP_003725653.1.54434 WP_003725653.1.54505 WP_003725653.1.54508 WP_003725653.1.54740 WP_003725653.1.54750 WP_003725653.1.55027 WP_003725653.1.55068 WP_003725653.1.5514 WP_003725653.1.55386 WP_003725653.1.55423 WP_003725653.1.55494 WP_003725653.1.55510 WP_003725653.1.55609 WP_003725653.1.55850 WP_003725653.1.56322 WP_003725653.1.56344 WP_003725653.1.56566 WP_003725653.1.56748 WP_003725653.1.5687 WP_003725653.1.57106 WP_003725653.1.57228 WP_003725653.1.57374 WP_003725653.1.57536 WP_003725653.1.57913 WP_003725653.1.57932 WP_003725653.1.58 WP_003725653.1.58083 WP_003725653.1.58491 WP_003725653.1.59113 WP_003725653.1.59353 WP_003725653.1.59493 WP_003725653.1.59652 WP_003725653.1.59695 WP_003725653.1.59720 WP_003725653.1.59744 WP_003725653.1.59826 WP_003725653.1.59975 WP_003725653.1.60132 WP_003725653.1.60162 WP_003725653.1.60295 WP_003725653.1.60762 WP_003725653.1.60766 WP_003725653.1.60768 WP_003725653.1.61072 WP_003725653.1.611 WP_003725653.1.61358 WP_003725653.1.61371 WP_003725653.1.61384 WP_003725653.1.61525 WP_003725653.1.61915 WP_003725653.1.6236 WP_003725653.1.62375 WP_003725653.1.62494 WP_003725653.1.62573 WP_003725653.1.62690 WP_003725653.1.6281 WP_003725653.1.62874 WP_003725653.1.63269 WP_003725653.1.63283 WP_003725653.1.63315 WP_003725653.1.63605 WP_003725653.1.63842 WP_003725653.1.63883 WP_003725653.1.64147 WP_003725653.1.64289 WP_003725653.1.64413 WP_003725653.1.64869 WP_003725653.1.64929 WP_003725653.1.65143 WP_003725653.1.65392 WP_003725653.1.65561 WP_003725653.1.65780 WP_003725653.1.66057 WP_003725653.1.66134 WP_003725653.1.66138 WP_003725653.1.66510 WP_003725653.1.66545 WP_003725653.1.66596 WP_003725653.1.66743 WP_003725653.1.66993 WP_003725653.1.6745 WP_003725653.1.67551 WP_003725653.1.67573 WP_003725653.1.67654 WP_003725653.1.67813 WP_003725653.1.67926 WP_003725653.1.68128 WP_003725653.1.68208 WP_003725653.1.68236 WP_003725653.1.68282 WP_003725653.1.68497 WP_003725653.1.68525 WP_003725653.1.68740 WP_003725653.1.69263 WP_003725653.1.69360 WP_003725653.1.69603 WP_003725653.1.6991 WP_003725653.1.69989 WP_003725653.1.70122 WP_003725653.1.7026 WP_003725653.1.70590 WP_003725653.1.70633 WP_003725653.1.71381 WP_003725653.1.71437 WP_003725653.1.71474 WP_003725653.1.71726 WP_003725653.1.7175 WP_003725653.1.71763 WP_003725653.1.71858 WP_003725653.1.72264 WP_003725653.1.72370 WP_003725653.1.72546 WP_003725653.1.72886 WP_003725653.1.72918 WP_003725653.1.73152 WP_003725653.1.73448 WP_003725653.1.73508 WP_003725653.1.73545 WP_003725653.1.73613 WP_003725653.1.74095 WP_003725653.1.7421 WP_003725653.1.74436 WP_003725653.1.74617 WP_003725653.1.74728 WP_003725653.1.74927 WP_003725653.1.74956 WP_003725653.1.7504 WP_003725653.1.75072 WP_003725653.1.75196 WP_003725653.1.75216 WP_003725653.1.7528 WP_003725653.1.7553 WP_003725653.1.75548 WP_003725653.1.7565 WP_003725653.1.75838 WP_003725653.1.75869 WP_003725653.1.75923 WP_003725653.1.76094 WP_003725653.1.76168 WP_003725653.1.76247 WP_003725653.1.76254 WP_003725653.1.76367 WP_003725653.1.76545 WP_003725653.1.76608 WP_003725653.1.76926 WP_003725653.1.76982 WP_003725653.1.7718 WP_003725653.1.77191 WP_003725653.1.77222 WP_003725653.1.77345 WP_003725653.1.7738 WP_003725653.1.77389 WP_003725653.1.77697 WP_003725653.1.77928 WP_003725653.1.77943 WP_003725653.1.78130 WP_003725653.1.78315 WP_003725653.1.78328 WP_003725653.1.78681 WP_003725653.1.78717 WP_003725653.1.79128 WP_003725653.1.79149 WP_003725653.1.79259 WP_003725653.1.79602 WP_003725653.1.80088 WP_003725653.1.80968 WP_003725653.1.81140 WP_003725653.1.81270 WP_003725653.1.81476 WP_003725653.1.81495 WP_003725653.1.8151 WP_003725653.1.81647 WP_003725653.1.81863 WP_003725653.1.82294 WP_003725653.1.82372 WP_003725653.1.82480 WP_003725653.1.82605 WP_003725653.1.82662 WP_003725653.1.82821 WP_003725653.1.83015 WP_003725653.1.83130 WP_003725653.1.83217 WP_003725653.1.83755 WP_003725653.1.83809 WP_003725653.1.83877 WP_003725653.1.83907 WP_003725653.1.8391 WP_003725653.1.84180 WP_003725653.1.8465 WP_003725653.1.85036 WP_003725653.1.85172 WP_003725653.1.85194 WP_003725653.1.85321 WP_003725653.1.8539 WP_003725653.1.85576 WP_003725653.1.85690 WP_003725653.1.85887 WP_003725653.1.85890 WP_003725653.1.86056 WP_003725653.1.86098 WP_003725653.1.86232 WP_003725653.1.86279 WP_003725653.1.86571 WP_003725653.1.86683 WP_003725653.1.87101 WP_003725653.1.8715 WP_003725653.1.87179 WP_003725653.1.87328 WP_003725653.1.87329 WP_003725653.1.87436 WP_003725653.1.87537 WP_003725653.1.87890 WP_003725653.1.87903 WP_003725653.1.88055 WP_003725653.1.88211 WP_003725653.1.88397 WP_003725653.1.88422 WP_003725653.1.88639 WP_003725653.1.88768 WP_003725653.1.88806 WP_003725653.1.88877 WP_003725653.1.88895 WP_003725653.1.88974 WP_003725653.1.89014 WP_003725653.1.89267 WP_003725653.1.89302 WP_003725653.1.89387 WP_003725653.1.89505 WP_003725653.1.89756 WP_003725653.1.89812 WP_003725653.1.89897 WP_003725653.1.89916 WP_003725653.1.89969 WP_003725653.1.90212 WP_003725653.1.90326 WP_003725653.1.90459 WP_003725653.1.90524 WP_003725653.1.90646 WP_003725653.1.90741 WP_003725653.1.90772 WP_003725653.1.90963 WP_003725653.1.91140 WP_003725653.1.91195 WP_003725653.1.91443 WP_003725653.1.91560 WP_003725653.1.91920 WP_003725653.1.91922 WP_003725653.1.9243 WP_003725653.1.92494 WP_003725653.1.92591 WP_003725653.1.9282 WP_003725653.1.92928 WP_003725653.1.92963 WP_003725653.1.93014 WP_003725653.1.93049 WP_003725653.1.93217 WP_003725653.1.93325 WP_003725653.1.93490 WP_003725653.1.93611 WP_003725653.1.93712 WP_003725653.1.93867 WP_003725653.1.94026 WP_003725653.1.94059 WP_003725653.1.94081 WP_003725653.1.94206 WP_003725653.1.94225 WP_003725653.1.94233 WP_003725653.1.94336 WP_003725653.1.94401 WP_003725653.1.94431 WP_003725653.1.94447 WP_003725653.1.94464 WP_003725653.1.94499 WP_003725653.1.94537 WP_003725653.1.94613 WP_003725653.1.9470 WP_003725653.1.94759 WP_003725653.1.94795 WP_003725653.1.94906 WP_003725653.1.9502 WP_003725653.1.9505 WP_003725653.1.95100 WP_003725653.1.95146 WP_003725653.1.9517 WP_003725653.1.95197 WP_003725653.1.95696 WP_003725653.1.96084 WP_003725653.1.96156 WP_003725653.1.96422 WP_003725653.1.96438 WP_003725653.1.96449 WP_003725653.1.96496 WP_003725653.1.96542 WP_003725653.1.96544 WP_003725653.1.96596 WP_003725653.1.96708 WP_003725653.1.96835 WP_003725653.1.96867 WP_003725653.1.97140 WP_003725653.1.97378 WP_003725653.1.97469 WP_003725653.1.97569 WP_003725653.1.97587 WP_003725653.1.97589 WP_003725653.1.9768 WP_003725653.1.9769 WP_003725653.1.97900 WP_003725653.1.97970 WP_003725653.1.9802 WP_003725653.1.98490 WP_003725653.1.98689 WP_003725653.1.98826 WP_003725653.1.98829 WP_003725653.1.98974 WP_003725653.1.99199 WP_003725653.1.99518 WP_003725653.1.99553 WP_003725653.1.99568 WP_003725653.1.99663 WP_003725653.1.99702 WP_003725653.1.99737 WP_003725653.1.99818 WP_003725653.1.99836 WP_003725653.1.99906 gi|405750172|ref|YP_006673638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]