SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226222666|ref|YP_002756773.1| from Listeria monocytogenes serotype 4b str. CLIP 80459

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226222666|ref|YP_002756773.1|
Domain Number 1 Region: 2-209
Classification Level Classification E-value
Superfamily CutC-like 9.81e-53
Family CutC-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226222666|ref|YP_002756773.1|
Sequence length 213
Comment copper homeostasis protein CutC [Listeria monocytogenes serotype 4b str. CLIP 80459]
Sequence
MILKEACIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGIAKHVVKICHEQNVSVMAM
VRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLLDKPAIIELLKATAGLE
VTFHMAFDELVDSEKLPAIDWLAEQDVTRILTHGGDGAKLPEETFLQWRKYIDYAAGRII
ILPGGGIKSHNMEWITKETGAAEIHGTDLFGER
Download sequence
Identical sequences A0A0B8R6P2 A0A0E1R292
gi|386730789|ref|YP_006204285.1| gi|405751233|ref|YP_006674698.1| gi|424712880|ref|YP_007013595.1| gi|406702804|ref|YP_006753158.1| WP_010958655.1.10210 WP_010958655.1.102150 WP_010958655.1.11689 WP_010958655.1.12020 WP_010958655.1.12993 WP_010958655.1.13004 WP_010958655.1.13360 WP_010958655.1.13855 WP_010958655.1.14875 WP_010958655.1.15122 WP_010958655.1.15342 WP_010958655.1.16516 WP_010958655.1.1678 WP_010958655.1.1688 WP_010958655.1.17106 WP_010958655.1.18289 WP_010958655.1.19112 WP_010958655.1.19246 WP_010958655.1.19452 WP_010958655.1.19472 WP_010958655.1.19584 WP_010958655.1.20263 WP_010958655.1.20378 WP_010958655.1.20672 WP_010958655.1.21429 WP_010958655.1.21874 WP_010958655.1.22188 WP_010958655.1.22194 WP_010958655.1.22221 WP_010958655.1.233 WP_010958655.1.23781 WP_010958655.1.23828 WP_010958655.1.24847 WP_010958655.1.24934 WP_010958655.1.25300 WP_010958655.1.25896 WP_010958655.1.26634 WP_010958655.1.27826 WP_010958655.1.27860 WP_010958655.1.28098 WP_010958655.1.28722 WP_010958655.1.28792 WP_010958655.1.28818 WP_010958655.1.29558 WP_010958655.1.29562 WP_010958655.1.29569 WP_010958655.1.31329 WP_010958655.1.32061 WP_010958655.1.32140 WP_010958655.1.32597 WP_010958655.1.33016 WP_010958655.1.34698 WP_010958655.1.34911 WP_010958655.1.35452 WP_010958655.1.36108 WP_010958655.1.36749 WP_010958655.1.37466 WP_010958655.1.37723 WP_010958655.1.37900 WP_010958655.1.37951 WP_010958655.1.39496 WP_010958655.1.39895 WP_010958655.1.40556 WP_010958655.1.41222 WP_010958655.1.42525 WP_010958655.1.42994 WP_010958655.1.43916 WP_010958655.1.44092 WP_010958655.1.44749 WP_010958655.1.45512 WP_010958655.1.45778 WP_010958655.1.4587 WP_010958655.1.45893 WP_010958655.1.46566 WP_010958655.1.46981 WP_010958655.1.47001 WP_010958655.1.47075 WP_010958655.1.47518 WP_010958655.1.48007 WP_010958655.1.48175 WP_010958655.1.48854 WP_010958655.1.49458 WP_010958655.1.50063 WP_010958655.1.51493 WP_010958655.1.53603 WP_010958655.1.54506 WP_010958655.1.54884 WP_010958655.1.5671 WP_010958655.1.58083 WP_010958655.1.58966 WP_010958655.1.59542 WP_010958655.1.60543 WP_010958655.1.60674 WP_010958655.1.61274 WP_010958655.1.61358 WP_010958655.1.63209 WP_010958655.1.63315 WP_010958655.1.64413 WP_010958655.1.64587 WP_010958655.1.64796 WP_010958655.1.65392 WP_010958655.1.66285 WP_010958655.1.68497 WP_010958655.1.68517 WP_010958655.1.69603 WP_010958655.1.70100 WP_010958655.1.70736 WP_010958655.1.71904 WP_010958655.1.72623 WP_010958655.1.72813 WP_010958655.1.73263 WP_010958655.1.74148 WP_010958655.1.74617 WP_010958655.1.74823 WP_010958655.1.77261 WP_010958655.1.77594 WP_010958655.1.77675 WP_010958655.1.77849 WP_010958655.1.78088 WP_010958655.1.79259 WP_010958655.1.79821 WP_010958655.1.80514 WP_010958655.1.80693 WP_010958655.1.81315 WP_010958655.1.82974 WP_010958655.1.84895 WP_010958655.1.84974 WP_010958655.1.85317 WP_010958655.1.86752 WP_010958655.1.87294 WP_010958655.1.88463 WP_010958655.1.88768 WP_010958655.1.88783 WP_010958655.1.90741 WP_010958655.1.90857 WP_010958655.1.91084 WP_010958655.1.92288 WP_010958655.1.92963 WP_010958655.1.93325 WP_010958655.1.93421 WP_010958655.1.93534 WP_010958655.1.93558 WP_010958655.1.94431 WP_010958655.1.94554 WP_010958655.1.96605 WP_010958655.1.96751 WP_010958655.1.97589 WP_010958655.1.97803 WP_010958655.1.99553 WP_010958655.1.99702 265669.LMOf2365_0029 634178.Lm4b_00029 gi|226222666|ref|YP_002756773.1| gi|46906252|ref|YP_012641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]