SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255534562|ref|YP_003094933.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255534562|ref|YP_003094933.1|
Domain Number 1 Region: 19-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.05e-48
Family PP-loop ATPase 0.00046
Further Details:      
 
Domain Number 2 Region: 347-430
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000233
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255534562|ref|YP_003094933.1|
Sequence length 434
Comment tRNA(Ile)-lysidine synthetase [Flavobacteriaceae bacterium 3519-10]
Sequence
MLTQATFDAQLLNLKPDPESARYLLAVSGGVDSMVLLYLFSHSNLEFEVAHVNYRLRGVD
SDADQRIVEEFCAKHHLTLHVYEVGDHDGKPANSVQLWARELRYGFFRKIQIQSDLQYIV
TAHHLNDQLETFIINLSRASGLNGLSGIPSNENGILRPLLNFTKNDIYDFAAQRSIQFGE
DVSNSKNDYLRNFIRNEIAHRLLETNTGFLPNFSRTIHYLDQAKDFIHEQISAVEDEIIS
HSDDSILIDREKFGQQSDFVKFEILRKLGFDSATEVQKIVAAEKGKCFKSADYILTVDRN
HLILNAIDSQEFEPKKIIITSDALKNPASISLRTFLPAEILPQPDFSWEFDADQLQFPLK
LRHRLAGDVFFPVGMAGSKKVAKFFKDEKIPIFAQRKMWLMCDGDDNILGVIPIRQDRRF
AADHNAKNIISVHF
Download sequence
Identical sequences C6X0I5
gi|255534562|ref|YP_003094933.1| WP_012782018.1.47966 531844.FIC_00404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]