SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|255535063|ref|YP_003095434.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255535063|ref|YP_003095434.1|
Domain Number 1 Region: 213-411
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-66
Family B3/B4 domain of PheRS, PheT 0.00000835
Further Details:      
 
Domain Number 2 Region: 41-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-41
Family Myf domain 0.0033
Further Details:      
 
Domain Number 3 Region: 482-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.12e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0015
Further Details:      
 
Domain Number 4 Region: 701-799
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-26
Family Anticodon-binding domain of PheRS 0.00098
Further Details:      
 
Domain Number 5 Region: 418-490
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000156
Family Domains B1 and B5 of PheRS-beta, PheT 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255535063|ref|YP_003095434.1|
Sequence length 800
Comment phenylalanyl-tRNA synthetase subunit beta [Flavobacteriaceae bacterium 3519-10]
Sequence
MKISNNWLQDFIKTDLKADKTAEYLTDIGLEVEGIDKYESVKGSLEGIVVGKVLTCSQHP
NADKLKKTTVDVGGGKILNIVCGAPNVEAGQTVPVAVVGTQLFMKDGSPLVIKEAKIRGE
VSQGMICAEDELGLSDDHGGIMVLDENKFEVGKNFADYFELTSDEVFEIGLTPNRTDAMS
HYGVARDLNAVLTSNQIKSTFEKLESKTLNITGTADFQLEVEDDALCPRYIGAVIENVKV
ADSPDWLKDRLKAIGLSPINNIVDITNYILHGFGQPLHAFDADKIEGKKVIVGVNAEGTK
FTTLDNIERTLNGSEIMIKDGAGKPMCIGGVLGGQTSGVSTETQTVFLESAYFNPVAVRK
AAKHHGLNTDASFRFERGVDPNSTRTAITHAIAMIEEVAGGKLAGALLEHYPEKIENNYV
ILRFSKVEQILGTKIHREKIKEILKLLDIQVLNEIQNGLEISVPAYRADVTREIDVIEEI
LRIYGYNKIDSPQKISFTPARLNPEDQDALENAWARTLQSNGFNEVMNNSLTSVKDETHA
VKLLNPLSSDLQFMRKSLLEGLLENADYNIKRKTADIKFFEFGKVYHKTDKYVERKQLAM
LVSGRNNAENWLLAKCATDFWYLKSYVKTLLDKLNLNIEEKSLEDARFSDALELAADGKT
IARLGKVSTELLKGADLDQDCFYAEIELETCQQLRSTGTFKFNDIPKFNKIRRDLALLVD
KNVTYAELYQQARKNPSKYLKNINLFDVYEGKNLPEGKKSYAMSFELLNEDKTLEEKDIS
EVMNSLINGFKKEFAAELRS
Download sequence
Identical sequences C6X4N4
gi|255535063|ref|YP_003095434.1| 531844.FIC_00921 WP_012782518.1.47966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]