SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226946773|ref|YP_002801846.1| from Azotobacter vinelandii DJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226946773|ref|YP_002801846.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.41e-32
Family Frataxin-like 0.0000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226946773|ref|YP_002801846.1|
Sequence length 110
Comment frataxin-like protein [Azotobacter vinelandii DJ]
Sequence
MSLTEARFHELIDDLQQNVEDVFEDSDLDVDLENSAGVLSVRFENGSQLILSRQEPLRQL
WLAARSGGFHFDYDEAGGRWICDASGDSLGELLARVTLEQIGEELEFPEL
Download sequence
Identical sequences C1DJ52 M9Y725
WP_012703233.1.101714 WP_012703233.1.69821 WP_012703233.1.78925 WP_012703233.1.92556 WP_012703233.1.99604 gi|226946773|ref|YP_002801846.1| 322710.Avin_47670 gi|482892900|ref|YP_007895655.1| gi|482897779|ref|YP_007900703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]