SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226943045|ref|YP_002798118.1| from Azotobacter vinelandii DJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226943045|ref|YP_002798118.1|
Domain Number 1 Region: 59-200
Classification Level Classification E-value
Superfamily CBS-domain pair 4.67e-33
Family CBS-domain pair 0.0035
Further Details:      
 
Domain Number 2 Region: 199-278
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.82e-22
Family CorC/HlyC domain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226943045|ref|YP_002798118.1|
Sequence length 280
Comment CBS domain-containing transporter [Azotobacter vinelandii DJ]
Sequence
MSDDRSSNGQSWLSKLTQAFAHEPRNRQELLEILHEAHQNELLDSEALTIVEGAIQVADL
QVRDIMVPRSQMVTVRADQTPREFLPTIIEEAHSRYPVIGESLDDIVGILLAKDLLPLLL
RGADEACACELRGLLRPATFVPESKRLNVLLREFRSTHNHMAIVIDEYGGVAGLVTIEDV
LEQIVGDIEDEHDVEEDSYIKELPSGDFVIKALMPIEDFNKHFDSQLPVNEFDTLGGLVA
HAFGHLPKRNETVEVGDFRFRVLNADSRRIHLLRLSPQRH
Download sequence
Identical sequences C1DMW3 M9YGH1
gi|482899652|ref|YP_007896978.1| gi|226943045|ref|YP_002798118.1| 322710.Avin_09040 WP_012699568.1.101714 WP_012699568.1.69821 WP_012699568.1.78925 WP_012699568.1.92556 WP_012699568.1.99604 gi|482897225|ref|YP_007891930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]