SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226943454|ref|YP_002798527.1| from Azotobacter vinelandii DJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226943454|ref|YP_002798527.1|
Domain Number 1 Region: 104-321
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.4e-75
Family MurCDEF 0.000000364
Further Details:      
 
Domain Number 2 Region: 322-470
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.59e-48
Family MurCDEF C-terminal domain 0.00000886
Further Details:      
 
Domain Number 3 Region: 21-105
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 5.76e-28
Family MurCD N-terminal domain 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226943454|ref|YP_002798527.1|
Sequence length 488
Comment UDP-N-acetylmuramate--L-alanine ligase [Azotobacter vinelandii DJ]
Sequence
MVKSQDAIQAEIRRMRRIGCIHFVGIGGAGMCGIAEVLLNLGYEVSGSDLKASPVTARLE
SFGAKIFIGHRAENAASADVLVVSSAVNSSNPEVMTALERRIPVVPRAEMLAELMRYRHG
IAVAGTHGKTTTTSLIASVFAAGGLDPTFVIGGRLNAAGTNAQLGSSRYLIAEADESDAS
FLHLQPMVAVVTNIDADHMDTYEGDFSRLKKTFVDFLHNLPFYGLAVLCVDDPVVREILP
LVARPTITYGLGEDADIRAVDIRQAGMRTYFTVLRQERAPLEMSVNMPGVHNVLNALATI
AIACDEGIDDTAIVQGLSGFQGVGRRFQVYGELQIEGGGVMLVDDYGHHPREVAAVLKAV
RGGWPDRRLVMVYQPHRFTRTRDLYEDFVQILSDANVLLLMEVYPAGEEPIPGADSRSLC
RSIRQRGQLDPIYVERGADIAPLLKPLLRPGDILLCQGAGDIGGLAPQLLRNPLFGGRPE
AVAQRELP
Download sequence
Identical sequences C1DQA0 M9YC01
322710.Avin_13260 gi|226943454|ref|YP_002798527.1| gi|482898413|ref|YP_007897386.1| WP_012699972.1.101714 WP_012699972.1.69821 WP_012699972.1.78925 WP_012699972.1.92556 WP_012699972.1.99604 gi|482892771|ref|YP_007892337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]