SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226945553|ref|YP_002800626.1| from Azotobacter vinelandii DJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226945553|ref|YP_002800626.1|
Domain Number 1 Region: 206-349
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-25
Family CBS-domain pair 0.0018
Further Details:      
 
Domain Number 2 Region: 343-427
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.73e-24
Family CorC/HlyC domain-like 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226945553|ref|YP_002800626.1|
Sequence length 432
Comment hemolysin-like protein [Azotobacter vinelandii DJ]
Sequence
MEAGLLLLLIALNGVFAMAEIAVVSSRKARLQRLADERRHGALVALALQDDPSRFLSTIQ
VGITTVGVLSGALGETLLARPLTQRIAELPALAPYAEAIALILTVAAITYLSVVVGELLP
KRLALLAPETIASALAPAMRRLAQIAAPLVWLLSYSCNLLLRLIGIGRRDEPPITDEEIQ
VLMEQGAEAGVFHESEQAFVANVLHLDEQPVGAIMSPRQQVYAIDLDDPREEQLRRLAES
PYTRVLVCRGGLHRLVGVLHRGDLLKPALQGQPIDLQRSARPPFYVEESASSTGLLEDFR
RTRNEFAVVVDEFDDLQGIVTLRDVLTAIVGEIPDALHDGEPAIVRREDGSWLVDGGMGI
EQLKTALDIDAAFPGEADNAYRTLAGLVMHCLQRVPSVSDHFELDGWRFEVVDMDRTRID
KVLVMRPSAPPA
Download sequence
Identical sequences C1DQL5 M9YLF8
gi|226945553|ref|YP_002800626.1| WP_012702031.1.101714 WP_012702031.1.69821 WP_012702031.1.78925 WP_012702031.1.92556 322710.Avin_35020 gi|482901457|ref|YP_007899482.1| gi|482896340|ref|YP_007894433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]