SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257386220|ref|YP_003175993.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257386220|ref|YP_003175993.1|
Domain Number 1 Region: 382-617
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.85e-58
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.0023
Further Details:      
 
Domain Number 2 Region: 112-331
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.83e-24
Family Tricorn protease N-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 14-102
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000314
Family DPP6 N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257386220|ref|YP_003175993.1|
Sequence length 617
Comment peptidase S9 prolyl oligopeptidase active site domain protein [Halomicrobium mukohataei DSM 12286]
Sequence
MDEDLLEALASLPTFHHATVSPDGNEVAVYYDETGRNELHVVDVATGERTRWSDGEVPRN
ARWHVEWGADGDRVFFHLDDDGNEQNDVYAIARDGSVEPVVQLDGQTVLQDVGEDGETLL
VGSTASGQMQLYRHDCATGETTQLTEYDRAVGAGVLSPDCERIAYATNETDTFENTDTYV
ADADGSNQRNLEIGETGAEVGPVDWGPDGDRLLVTDNTADLGRCGVYDLSTDEVTWYGGE
FDEDAESFLPGGDRFLAVRTRECAKEVVVYDARTGAATTLDLPSGVASLGRAGSAVVDEE
RIVCSHTTPDRRPELLCYDLATDETEQLIAADYGDLDPDRFVDAEYFTFDSAGVAEFDDR
AGQGVESDPASREIEALLYDSGERPSPAIVNPHGGPRGQDTRGFDLYTQFLCSQGYSVLK
VNYRGSTGRGREFAQAIYDDWGGNEQADIATGTTILAEKEWVDDDRIAVFGGSYGGYSAY
CQMTMYPELYDAGVAWIGVTDLRDLYENTMPHYRTELLEKNVGSPEENPALYDERSPITH
AENLAAPLLVLHGVNDRRVPVSQARLFRDRLDELGYEAGEDGDYEYVELGEEGHASTDVD
QKIRTFRTLADFLERRL
Download sequence
Identical sequences C7NWE5
gi|257386220|ref|YP_003175993.1| WP_012807679.1.83741 485914.Hmuk_0148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]