SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221229460|ref|YP_002502876.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221229460|ref|YP_002502876.1|
Domain Number 1 Region: 14-212
Classification Level Classification E-value
Superfamily Formyltransferase 1.16e-54
Family Formyltransferase 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221229460|ref|YP_002502876.1|
Sequence length 215
Comment phosphoribosylglycinamide formyltransferase [Mycobacterium leprae Br4923]
Sequence
MQEPLCVSPSAPSRVVVLASGTGSLLGSLIDASVGNYPARVVAVGVDRDCGATKIAKAAS
VPTFTVRLADPPGRDAWDAKITEAVASYKPDLVVLAGFMRILGPQFLARFFGRIVNTHPA
LLPAFPGTHGVADALAYGVKVTGATVHLVDAGTDTGPILAQQSVPVLDGDDTAALHERIK
VIERRLLVDVVAVIATGGVTLVGRKATIGRKATIE
Download sequence
Identical sequences A0A0H3MPF6 A0A197SCR2 Q7AQN4 Q9Z5H6
gi|15826982|ref|NP_301245.1| gi|221229460|ref|YP_002502876.1| NP_301245.1.10168 WP_010907570.1.20769 WP_010907570.1.50976 WP_010907570.1.86095 272631.ML0160 561304.MLBr_00160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]