SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221229649|ref|YP_002503065.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221229649|ref|YP_002503065.1|
Domain Number 1 Region: 112-290,425-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000398
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 1.7e-32
Family GAD domain 0.00051
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-28
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221229649|ref|YP_002503065.1|
Sequence length 589
Comment aspartyl-tRNA synthetase [Mycobacterium leprae Br4923]
Sequence
MLRSHGAGVLRKSDAGQQVTLAGWVSRRRDHGGVIFIDLRDSSGITQAVFREPDVLAQAH
RLRAEFCIAVSGVVEIRPEGNANAEIPTGDIEVNATSLTVLGESAPLPFQLDEPAGEELR
LKYRYLDLRRDGPGSAIRLRSKVNATARAVLARHDFVEIETPTITRSTPEGARDFLVPAR
LRPGTFYALPQSPQLFKQLLMVAGMERYYQIAHCYRDEDFRADRQPEFTQLDMEMSFVDA
EDVIAISEEILTELWMLIGYHIPAPIPRISYADAMRRFGSDKPDLRFGLELVECTEFFCD
TTFRVFQAPYVGAVVMPGGAAQPRRTLDEWQDWAKQRGHRGLAYVLVTDDGTLGGPVAKN
FSDAERSRLASHVGAEPGDCIFFSAGPAKSSRALLGAARGEIANRLGLIDPEAWAFVWVV
DPPLFERADEATKVGEMAVGSGAWTAVHHAFTSPKPEFEDSIESDPGSVLADAYDIVCNG
HEIGSGSVRINRRDIQERVFAVMGLEKAEAEEKFGFLLEAFTFGAPPHGGIAFGWDRTNA
LLAGMESIREVIAFPKTGGGVDPLTDAPASITAQQRKESGIDTKPKEVE
Download sequence
Identical sequences A0A197SBJ5 B8ZUJ3 P36429
gi|221229649|ref|YP_002503065.1| 272631.ML0501 561304.MLBr_00501 MyleA.00145.a gi|15827171|ref|NP_301434.1| NP_301434.1.10168 WP_010907758.1.20769 WP_010907758.1.50976 WP_010907758.1.86095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]