SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221229682|ref|YP_002503098.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221229682|ref|YP_002503098.1|
Domain Number 1 Region: 4-208
Classification Level Classification E-value
Superfamily Formyltransferase 2.22e-51
Family Formyltransferase 0.0000191
Further Details:      
 
Domain Number 2 Region: 207-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.61e-23
Family Post formyltransferase domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221229682|ref|YP_002503098.1|
Sequence length 318
Comment methionyl-tRNA formyltransferase [Mycobacterium leprae Br4923]
Sequence
MLVRLVFAGTPESALPALCRLIDSPRHDVIAVLTRPDAASGRRGKPEPSPVAREALDRGI
PLLRPARPNSPVFVSELSEWAPECCVVVAYGALLGSPLLAVPPRGWVNLHFSLLPAWRGA
APVQAAIAAGDTITGATTFQIEPSLDSGPVYGVVTETIQPTDTAGDLLERLAVSGATLLS
STLDGIADAILTPRQQPVDGVSFAPKITVEQARVCWDLPAPVVERRIRAVTPNPGAWTLV
GKLRVKLGPVRFDSGAVEVPRLLKPLLPGGIHVDHKSVWIGTGSDPVRLSKVQPQGKKFM
NAVDWAHGARLDPAARAS
Download sequence
Identical sequences B8ZUM6 Q9CCQ0
gi|15827204|ref|NP_301467.1| 272631.ML0552 561304.MLBr_00552 gi|221229682|ref|YP_002503098.1| NP_301467.1.10168 WP_010907791.1.20769 WP_010907791.1.50976 WP_010907791.1.86095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]