SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221230052|ref|YP_002503468.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221230052|ref|YP_002503468.1|
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.44e-79
Family ATP synthase (F1-ATPase), gamma subunit 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221230052|ref|YP_002503468.1|
Sequence length 298
Comment ATP synthase F0F1 subunit gamma [Mycobacterium leprae Br4923]
Sequence
MAATLRELRGRIRSVGSIKKITKAQELIATSRIARAQVRLESARPYAVDITRMLTTLAYE
AVLDHPLLVASATPKRAGVLVVSSDRGLCGAYNANVFRRSEELFSLLRAEGKTPILYVVG
RKALNYYTFRNWGIAESWTGFSEQPKYENAAKIASTLVDVFMLGSSESDAGVDELHIVFT
EFKSMLSQSTKARRMAPMVVEYVEESKLPRTLYSFEPDATTLFEALLPRYLTIRVYAAML
ESAASELASRQRAMKSATDNADDLIKALTLEANRERQAQITQEISEIVGGANALANAR
Download sequence
Identical sequences A0A197S9T1 B8ZR41 P45824
gi|221230052|ref|YP_002503468.1| 272631.ML1144 561304.MLBr_01144 gi|15827575|ref|NP_301838.1| NP_301838.1.10168 WP_010908162.1.20769 WP_010908162.1.50976 WP_010908162.1.86095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]