SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221230495|ref|YP_002503911.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221230495|ref|YP_002503911.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.53e-79
Family Ribosomal protein L1 0.000000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221230495|ref|YP_002503911.1|
Sequence length 235
Comment 50S ribosomal protein L1 [Mycobacterium leprae Br4923]
Sequence
MSKSSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGVDSRKADQMVR
GTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDLIEKIQGGWLEFDAAVATPDQ
MAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVADIKGGKINFRVDKQANLHFVIGKASF
DEKRLAENYGAALEEVLRLKPSSSKGRYLKKVTVSTTMGPGIPVDPSITRNFTEE
Download sequence
Identical sequences A0A197SDB1 B8ZSD5 Q9CBK2
gi|15828018|ref|NP_302281.1| NP_302281.1.10168 WP_010908602.1.20769 WP_010908602.1.50976 WP_010908602.1.86095 272631.ML1904 561304.MLBr_01904 MyleA.00328.a gi|221230495|ref|YP_002503911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]