SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227832024|ref|YP_002833731.1| from Corynebacterium aurimucosum ATCC 700975

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227832024|ref|YP_002833731.1|
Domain Number 1 Region: 13-514
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.62e-189
Family Heme-dependent catalases 0.000000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227832024|ref|YP_002833731.1|
Sequence length 518
Comment Catalase [Corynebacterium aurimucosum ATCC 700975]
Sequence
MTNASNESAADKVLDKGQRAPGGPNTTRPSGQPIATENTSITAGENGPVVLNDIHLIEKL
AHFNRERVPERTPHAKGHGAFGELHVTEDVSAYTKAKLFQKGTVTPMMGRFSTVAGEQGS
PDTWRDVHGFALRFYTEDGNYDIVGNNTPVFFIRDGIKFPDFIHSQKRLGTNGLRDADMQ
WDFWTRNPETTHQVTYLMGDRGTPKTTRHQNGYGSHTFQWVNESGDAFWVKYHFKTRQGV
ENFTDAEATEIAGKNADYHREDLYNAIEEGNFPVWDVKVQIMPVAEAEEYRFNPFDLTKT
WSKKDYPLVDVGYFVLNRNPRNFFAQIEQVALDPSNIVPGIGLSPDKMLQARVFAYSDQQ
RYRIGPNYKQLPVNQPLNQVNTYEHEGPMQYLFNAPEDPVYSPNRHAKGGGYLDGDENLR
FKEQETTTAPDLYVNPDPAGIDLVRAPYVHHAEDNDTVQATDLYENVYDDGAKERLADNI
TNAMAGVSPETEERIYAYWDAVSPQLGKRVRELFAEKK
Download sequence
Identical sequences C3PJS2
169292.cauri_0194 gi|227832024|ref|YP_002833731.1| WP_010189976.1.1812 WP_010189976.1.84091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]