SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227833220|ref|YP_002834927.1| from Corynebacterium aurimucosum ATCC 700975

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227833220|ref|YP_002834927.1|
Domain Number 1 Region: 114-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-102
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000811
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 2.94e-35
Family GAD domain 0.00078
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.95e-31
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227833220|ref|YP_002834927.1|
Sequence length 606
Comment aspartyl-tRNA synthetase [Corynebacterium aurimucosum ATCC 700975]
Sequence
MLRTHLAGELRKEMAGETVTLTGWVARRRDHGGVIFIDLRDRSGVAQVVFRESEVAERAH
DLRSEYCVKVTGVVEPRPEGSANANLASGEIEVNVSDLEVLNKSAALPFQIDDPSSSGEV
GEETRLKYRYLDLRRERQHEALRLRSAANRAAREVLDSHDFTEIETPTLTRSTPEGARDF
LVPARLKPGSWYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEM
SFVDQDDVIALAEEIVSALWKLIGYEIKTPIPRMTYADAMKYYGSDKPDLRFDIKIVECT
EFFKDTTFRVFQNEYVGAVVMEGGASQPRRQFDAWQEWAKQRGAKGLAYITIAEDGTLGG
PVAKNITDAEREGIAEHVGAKPGDAIFFAAGDVKSSRALLGAARGEIAKKLDLIKDGDWA
FTWVVDAPLFEPAADATASGDVALGHSKWTAVHHAFTSPKPEYLDSFDENPGEALAYAYD
IVCNGNEIGGGSIRIHDQDVQKRVFDVMGIGEEEAQEKFGFLLDAFQFGAPPHGGIAFGW
DRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPGTIPAEQRKETGVDFKPEKAAKAAQGE
KAGKES
Download sequence
Identical sequences C3PGN5
WP_010190145.1.1812 WP_010190145.1.84091 169292.cauri_1396 gi|227833220|ref|YP_002834927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]