SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148654252|ref|YP_001274457.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148654252|ref|YP_001274457.1|
Domain Number 1 Region: 48-433
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.44e-105
Family Homocysteine S-methyltransferase 0.00000152
Further Details:      
 
Domain Number 2 Region: 974-1250
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 7.72e-81
Family Methionine synthase SAM-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 391-659
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.7e-76
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00065
Further Details:      
 
Domain Number 4 Region: 784-933
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.22e-35
Family Cobalamin (vitamin B12)-binding domain 0.0000856
Further Details:      
 
Domain Number 5 Region: 746-797
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.00000000000000536
Family Methionine synthase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148654252|ref|YP_001274457.1|
Sequence length 1254
Comment methionine synthase [Roseiflexus sp. RS-1]
Sequence
MRLPEPHAGAWGFLLHKRESAIIAPASPIITCRQFGYEVSRGVSLKKPTYLEALRERVLI
YDGAMGTSIDTFHLTAADYGGENTFGARDYLVMTRPDVIEQIHTSFLEAGADVLETCTFQ
STRIRLEEWGLADQTHAINVAAARLARRVADAFEARDGRPRYVAGSMGPTGKLPSSDDPS
LSDITFDQLSDIFYEQAVALIEGGVDVLLVETSVDILEVKAALDGIRRAKADLNRPDVAV
QAQVFLDLSGKMLLGTEVPALVATLEAMPVDVIGLNCSTGPEHMREAIRYMTRHSRKPIS
CIPNAGLPIEVNGETVYPMEPEPFARILGEYVHEYGVAVVGGCCGTRPAHIRRLRQVVGA
ATPPKVRDIEYIPSVSSGVRAAALRQEGTLTIIGERVNTLGSRKVKRLLLNDDYDGVLEV
AREQVDSGSHILDVCVAMTERSDEREMMVRLLKKLTMNIELPLAIDTTEADVLNAALAIY
PGRAIVNSVSLEGGRGDKIDRTMPLVARYGAATIAMTIDEEGMAHTAERKLAIARRIAQI
AQDEYGVPPEALIFDVLTFPITTGQPELRRAAIETIEGIRLVKQHIPGCFTTLGVSNLSF
GVAPYARAALNSVFLKHAVDAGLDTAIINPAHVMPYAEIPPEQIRVCEDLIFDRDEQALA
RFIQFFEEHGSAAKTERVDPTEGMTAAQRVHWKIVHRKKEGIEQDIDTVIAERIREAEMR
AGIHDSALDPAHPSREAIFASPFRNSAAVDVLNTVLLPAMKEVGDLFGAGQLILPFVLQS
AEVMKKAVAHLEQYLEKLEGVTKGKIVLATVYGDVHDIGKNLVHTILANNGYTVYDLGKQ
VPINTIIEKAVEVNADAIGLSALLVSTSKQMPLCVQELHRRGLKFPVLVGGAAINKQYGQ
RILFVDDHTPYEPGVFYCKDAFEGLETVDALVDPSTRATFIERTKAEAAEALGKKQRGRV
ALAELGRATLSDTAKVRSAVRTDVPVPTPPFWGARVLTRIKLADVVECLDRNALYRLQWG
AKNAKGEEWEHLKADFDAKVRDLIREAERDGWLEPKVVYGYYPCQSDGHEVIVYDPPSVL
NGAQPRELTRFVFPRQPERERLCLADYFRSRESGEYDVVGLQIVTMGRKVDDLTETLQQS
GDYSRAYFIHGLGVSLAEALAEYTNRLIRRQLGLKGTQGKRYSWGYPACPDLEEHEKLFR
VLPAAEIGVTLTEAWQLVPEQSTAAIVIHHPEAKYFSIGSARERAEEDVAETLA
Download sequence
Identical sequences A5UPF4
gi|148654252|ref|YP_001274457.1| 357808.RoseRS_0064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]