SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148654739|ref|YP_001274944.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148654739|ref|YP_001274944.1|
Domain Number 1 Region: 375-625
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.22e-57
Family Tetrapyrrole methylase 0.0015
Further Details:      
 
Domain Number 2 Region: 5-181,217-245
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.4e-57
Family CbiG N-terminal domain-like 0.00034
Further Details:      
 
Domain Number 3 Region: 231-358
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.07e-34
Family CobE/GbiG C-terminal domain-like 0.00034
Further Details:      
 
Domain Number 4 Region: 652-758
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.36e-18
Family Siroheme synthase N-terminal domain-like 0.0013
Further Details:      
 
Domain Number 5 Region: 760-796
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.00000128
Family Siroheme synthase middle domains-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148654739|ref|YP_001274944.1|
Sequence length 800
Comment precorrin-3B C(17)-methyltransferase [Roseiflexus sp. RS-1]
Sequence
MNADTVIIAVTRAGTRLAARLAAELRAAAHVPAKFAAEAPYATPYTAALLDEVRTCWGDY
RALVLIMASGIAVRAIAPLIARKTIDPAVVVLDESGRFVIPLLGGHQAGANDLARRIAAI
TGGQAAITTASDTRGLPALDLLGRDRGWQIADDSALTHTMACLVNGDLVGCFVDPALPDA
RRLVIEQGADCPNLEYVDDPASLTDPRFAAALLVTHRRIDDLWQTLREKSVRYLPPVLIV
GIGCRRGVSVDELHDALRTTLADAGLDEQCVGALATADIKADEPGLVEIAGRLNVPLHVV
SRSEITALDAARFSPSAAVTHFDLPGVAEPCAMIAGGGDLLVPKRAFRRCTVAVALRNDT
PYQPSNVATTAPAAHPSGVLTLVGIGPGDLGHLTYAAHAALRDADVVAGYRVYIDLIRPL
LQPWQEVIVTPAMGDEIGRARQAIAVARSGRRVALISSGDIGIYAMAAPVFEILRDEGWT
GDHPAVDVVPGISAFQALAARLGAPIGHDMCIISLSDLLTPWDVIERRLRAAAQADFIVA
LYNPRSRGRDWQLDAALNIMRTHRPPTTPVAFGRNVSRADERITLTTLAAADPSCADMFT
VVLIGNSQSYILGNRMATPRGYARKGQVVLEETAADRRDAPIPGTQRDYPVTLINPGDLS
AVVIGGGAVGERKVRGLLNAGIPVRLVSPTATPHLAAWADAGLIVWNRREYEPGDLAGVW
LVFAATDQRDVNAQIARNAAAAGILCNVADAPEEGSFHVPAVHRSGGITIAVSSGGVAPA
RAVALRNALAQWLGEGDVEG
Download sequence
Identical sequences A5UQU1
gi|148654739|ref|YP_001274944.1| 357808.RoseRS_0572 WP_011955350.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]