SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148655652|ref|YP_001275857.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148655652|ref|YP_001275857.1|
Domain Number 1 Region: 170-213,252-449,548-665
Classification Level Classification E-value
Superfamily Subtilisin-like 6.41e-67
Family Subtilases 0.0016
Further Details:      
 
Domain Number 2 Region: 461-525
Classification Level Classification E-value
Superfamily PA domain 0.000000288
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148655652|ref|YP_001275857.1|
Sequence length 1116
Comment protease domain-containing protein [Roseiflexus sp. RS-1]
Sequence
MRHLARYARITAFMLVLVVALASVAPMRNVAAQTRPNRPTPGTPLTIEPVTVVSREDLAV
NKNLAVSRDGTLASVFIKIDSPSLASYMAQNGITDINAPAAQSYLQQLNAELDALVAQAK
QRVPGLRVTHRFDLIIGGVSVVAPVGEIDKLRRLPNVVEIINDRIERIETYRTPAFIGAT
TAWGKGGGSAFAGEGVIFGVLDSGVWPEHPSFSDPDPLGKPYAPPPPAPGNPGGVRACNF
GSATPGDAPFTCNNKLIGSYRFMTAYDFFVGTEPYEFRSGRDDDGHGTHTASTAAGNRGV
PASDGSRVFGTISGIAPRAYVVNYKVCGEVGCFTTDSAAAVQQAIRDGVHVINFSISGGT
NPYSDIASLAFLDAYNAGILVSASAGNSGPAADTVNHREPWVATVGASTSDRSYLSTLTV
QGVSGTFTAVGASSGAGISTPAPIVVNTADPLCQNPALPGTFTGKIVVCRRGVIARVAKS
ANVAAGGAIGMILYNPTPNSLDADFHVIPTVHLQNTDGTALLTFLTANPGATATFTPGAP
GPIQGDVMAGFSSRGGPGQTLGISKPDVTAPGVNILAGYTAIEYGQPVPQFAFLSGTSMS
SPHNAGAAILLKWLNPTWTPGQIKSALMTSARSAGVFKEDGVTPFTPFDAGSGRIDLRKA
WDPGLTFDETGAGYVALKDELWKANYPSLYVPKMPGRITVSRTVREVSGYDSFYKSSISY
RAGQPRDFTITVPREFFVPANGTYTFDITVDARDVPVGQVRHAVVVFTERNGCRVRFPIT
IVRGEPDIRMDKQCNPATLALRGTTDCTISITNTTFQNASVTLNDTMPRQLKLVSGSVTG
GATEVDNGLTFSGTLTGAAPPDVSAGRLTFNGYLSLAGLGASPNVPLGDETIVNLTLTRP
FLFGGQTYDTIGMVSNGYAVVGGGTAADVQFINRTFPNTARPNNTLGAFWTDLDGSAGGS
YYAYLVGFGPCSNPANACWLILEWENAPNWSNNSQRNTFQIWIGLNGVEDITYSYGPILS
SGDGGYVTVGAENAFGNRGANIYSNDGVGPIIGTIPTANSNDVYIETTPGAPGQTVTIGF
RAQGVRVGRWTNYAELTSPAFFGTYIDPFSGEVVRP
Download sequence
Identical sequences A5UTF4
357808.RoseRS_1513 WP_011956257.1.23570 gi|148655652|ref|YP_001275857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]