SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148655704|ref|YP_001275909.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148655704|ref|YP_001275909.1|
Domain Number 1 Region: 181-227
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000575
Family Achaeal helicase C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148655704|ref|YP_001275909.1|
Sequence length 431
Comment hypothetical protein RoseRS_1567 [Roseiflexus sp. RS-1]
Sequence
MAAHERLSFDRDPPDGESEVRSVDAGWEERAAFRIAIESRLVEEGRLIWRTRAYHEEHDQ
ERVWTGLPDEAIIEWFLERLRQSLGSPVSADTALALPESSAVAAAVAHPSAAPSPETPLP
PVAPPSEAALPPAAPSLETTVPSAAEPSVSAILPAAPSLETAVPPAAEPVEPAAERFHQD
DLQQIPGIGPAIARRLHAAGISTFAAVAACTPAELARHTGRSAEQIVRMGWIERARDLAL
SSRAESQPAPETKEREDMVSEEPSILFAAILLDEEGEVRDAHLTTAGEIPPEWNDQRVAR
FFMEAVAPADTTSSNIALHIDNPLIELIRAQPGKRNAYRLSANATVRIEGVDTVTAGVSA
HLFLLAYNLDSHETHILNTAGVSLAAGATEAPFTLDSDLPEVGHYQLVLAALIPEMRILT
AVSGPPLRVTP
Download sequence
Identical sequences A5UTK6
gi|148655704|ref|YP_001275909.1| 357808.RoseRS_1567 WP_011956308.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]