SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148656631|ref|YP_001276836.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148656631|ref|YP_001276836.1|
Domain Number 1 Region: 272-366
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|148656631|ref|YP_001276836.1|
Domain Number - Region: 122-202
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0628
Family MJ1460-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148656631|ref|YP_001276836.1|
Sequence length 388
Comment anti-sigma-factor antagonist [Roseiflexus sp. RS-1]
Sequence
MDSLQIRVHFVVCVVLPYERVWFIFGCGRRPMSNEVFTDHYAVVLNRAPFEWSVNEGRLR
FFGIPSALLWLNPSLLNILRPLADEIGIPLFRLLVAHSGSFGTAEDYHDVVKALGATFEE
GLLAWGEVISTIGWGRLELPFCDMQQRRAIVRIRNPWELDMQRGQAVNWGCPFLQGKIIG
LFTHAFGVPCWADEKNMVTDGDETSVEFHVYESNRTIESEIAILREARERERQQRLLDEI
AAKTLELQKANEERLQLQEQIIAMQARTLAELSTPLIPLNKRVLLMPLIGAFDSQRTQLT
VDRLLHGVAEYHASVVILDITGVPIVDTHVASALMQAAQAVRLLGAEVVLTGIRPEVAQT
LVGMGVSLQGIVTRGTLQSGIEYANSTQ
Download sequence
Identical sequences A5UW83
WP_011957230.1.23570 357808.RoseRS_2509 gi|148656631|ref|YP_001276836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]