SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148657301|ref|YP_001277506.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148657301|ref|YP_001277506.1|
Domain Number 1 Region: 89-225
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.44e-49
Family Molybdopterin synthase subunit MoaE 0.000095
Further Details:      
 
Domain Number 2 Region: 6-83
Classification Level Classification E-value
Superfamily MoaD/ThiS 4.86e-20
Family MoaD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148657301|ref|YP_001277506.1|
Sequence length 238
Comment molybdopterin converting factor subunit 1 [Roseiflexus sp. RS-1]
Sequence
MADTITIIVRYFAAHREITGRSDETLTLAPGTTVGALWTLLTERYPRLAGYSGRLLFAVN
QEFATPDQSLHHGDEVAFIPPVSGGAPRAFVVTHEPLDPAPLVALVQSPDMGAVVTFAGV
VRNHFGGRKTAFLEYEAYTGMAEAVLEQIAGEARTRWNTGGIAVHHRIGRLEIGETAVLV
VVAAPHRREAFEAAAWIMDRVKEIAPIWKKEYWADGAAEWVGDEKERKREVPDQGSTT
Download sequence
Identical sequences A5UY53
WP_011957900.1.23570 357808.RoseRS_3195 gi|148657301|ref|YP_001277506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]