SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148657334|ref|YP_001277539.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148657334|ref|YP_001277539.1|
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.32e-65
Family DmpA-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148657334|ref|YP_001277539.1|
Sequence length 318
Comment peptidase S58, DmpA [Roseiflexus sp. RS-1]
Sequence
MNPSITDVPGVLAGHAQDNEALTGCTVILTPEGAVGAVDVRGGAPGTRETDLLAPVATVA
TVHAVALCGGSAFGLAAATGVVQWLAERGIGFPTGVRNVPIVPAAVIFDLAIGRADRFAD
AAMGYAACNAAGATVEEGCVGVGIGATVGKIRGMQYAMKSGIGSWSERLTDGITVGALAV
CNAFGDVYDERGSRLLAGVRADDGSLADTMALLRAMVGVPPSEGQNTTLAVVATDARLTK
AEATKMAQMAQDALARTIRPVHTPFDGDTVFVLATGRRASPGLLPLGAVAVDVLARAIER
SVTQAWSLGGVVGLKGGG
Download sequence
Identical sequences A5UY86
WP_011957933.1.23570 gi|148657334|ref|YP_001277539.1| 357808.RoseRS_3228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]