SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148658526|ref|YP_001278731.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148658526|ref|YP_001278731.1|
Domain Number 1 Region: 141-210
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000000000000994
Family MJ1460-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148658526|ref|YP_001278731.1|
Sequence length 215
Comment 4-vinyl reductase, 4VR [Roseiflexus sp. RS-1]
Sequence
MPDERGSADEPEARYYPNLIGRLYLISLEDVMGRNGVNALLNLAGTRHLVNNYPPNNLKR
EFPFSDLSAISKATETMYGPRGARGMELRAGRYAFNLGLKEFGPLLGMADLALKLMPMTM
KMKIVLNATAQTFDRFSDQPSHVEERKGQFLYIIDKCPICWGRKSDRPVGHLAQGILEEA
LTWVTGGHSFRIEQTECQGMGCERCIFAIDKDPVD
Download sequence
Identical sequences A5V1M8
2010244228 gi|148658526|ref|YP_001278731.1| 357808.RoseRS_4449 WP_011959118.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]