SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148655059|ref|YP_001275264.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148655059|ref|YP_001275264.1|
Domain Number 1 Region: 4-213,916-1005
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-21
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 472-559
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000000000392
Family Rad50 coiled-coil Zn hook 0.01
Further Details:      
 
Domain Number 3 Region: 623-792,871-1019
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000109
Family ABC transporter ATPase domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148655059|ref|YP_001275264.1|
Sequence length 1022
Comment SMC domain-containing protein [Roseiflexus sp. RS-1]
Sequence
MIPRKLALQNFMCYREGLPPLEFDGMSIACLAGENGAGKSALLDAITWALWGEARLKSDD
DLVALGATEMMVELEFTLDGQDYRVIRRRIRGKRGGQSQLDFQVRDGNEWRSLTPGGIRE
TQQLIIRTLRMDYEMFANSAYLRQGRADEFTRKEPAKRKQVLADILGLSIYEELEGRAKE
RARSTEGQIRGLEGQIGELRRQAERYDLLVEEVHTAEERVADAMKRVEAARLALEEATAS
VQKLEQVRTIRDNLHTQTQRRRREREDQAQWLDRQMETQKRAESWIARRAEIEEGIRLLR
AAKAECDRLAALRDEYDHLQSRRAALAQALANAEHAIRSDLRVAETQVQTLRERAARRPK
LAAELQRLAAQLAEHPPIAEALSAARTRRATLTERLRRVNELLRRRTELESDIKLKHDSL
VATREEQKRTLRTLAEQLKHEARWRTELAEATAERARLEQEAAHLDTLRDDERALAEKIG
AIRAECETVKKQGDQINEKLRLLGPDLKVCPLCKSELGHDGIAHIQAEYERERQALRQQY
AAAKREADHLEAHLKRLRNDIRTIEARVNTLPDVQGRIARLESELAKCDVCRQQQIEAQR
LHDDVALRLLKNDYEPAAREELKRIDAEINALGSVDALEREIAAVERQVAALEDRSREQA
SVQAKIDGLQREIQQIDSEDPALHEQEQIVAALSAQLAQGDFAHTERAALADIDRQIAAL
GYSRERYDQAQADVQALVHWEEDLIRLQRAEEWLAENRDELARAAERLRQLDAQIAADEE
EVRSLDERLCDLAPAARARAEAAARLDELNHEVMARQKDLGERQADLRRAQEATSALAEA
EAHRQALLERKGLFDELTQAFGKKGIQAMLIETALPELEREANRLLSRMTDNQLHLTFET
QRDTKKGEVAETLDIKIADALGTRVYDAYSGGEAFRLDFAIRIALSKLLARRAGARLETL
IIDEGFGSQDARGRERLVEAIISVQHDFRRVLVITHIQELKDMFPVQIEIVKTPNGSVWN
IV
Download sequence
Identical sequences A5URR1
357808.RoseRS_0905 gi|148655059|ref|YP_001275264.1| WP_011955667.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]