SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121607257|ref|YP_995064.1| from Verminephrobacter eiseniae EF01-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121607257|ref|YP_995064.1|
Domain Number 1 Region: 98-259
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 2.88e-47
Family PA2201 C-terminal domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121607257|ref|YP_995064.1|
Sequence length 442
Comment hypothetical protein Veis_0255 [Verminephrobacter eiseniae EF01-2]
Sequence
MRDPDGKLETYEGKIEFCIRRLKQLSKNEDKEIFTRWHNTLSTFPRVIEYMLFRYGRGDP
LADIWSYFEKDGWPFYQRVVVHAKQLPPLSPDKDQERPSIGLFIGARSARTVNFFLAFLL
CMDESSERIINHRNWLFMDPPCPLVDVMLKSFIPNHRGVPNYKYNKYRQWWTFPLVNALA
QPPEQRPAALAAHMNNWYRLMRPLGWKPNRDPALEKDGLFCDFAFEVALAVCAYDIDDSS
FRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPPVPPKRVDLAKSKRKNFARWV
ELACDGYDDAVESVLETTGKPRKIQDFFQLLEALQDVGHAIHADGKDSDTLDSQAADLAD
ARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQLIDLDDQDDAWHAVLVKTEYHD
EFLALSQALGLRTRKPQQAYLD
Download sequence
Identical sequences A1WEI9
gi|121607257|ref|YP_995064.1| WP_011808065.1.29080 391735.Veis_0255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]