SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121607261|ref|YP_995068.1| from Verminephrobacter eiseniae EF01-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121607261|ref|YP_995068.1|
Domain Number 1 Region: 97-259
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.96e-47
Family PA2201 C-terminal domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121607261|ref|YP_995068.1|
Sequence length 442
Comment hypothetical protein Veis_0259 [Verminephrobacter eiseniae EF01-2]
Sequence
MRDPDGKLETYKEEMELYIYVLDHISKDESLDAIVRWNNGSRVLPYVIKCMLFRYGRGDP
LTDIWSYFEKDGWPFYQRAVAIVKQLPPQSLDESQRRAFFGLLTGEFAALEVHFFLALLI
CMDQSPERLMNHRNWLRVNPPRRFIDVMLKSFIPNHQGSSNYKSSTEQKWWTSPLMNALA
HPPEQRSAALAAHMDNWHRLMRPLGWKPNRDPALEKDGLFCYFAFEVAMAVCAYDIDDSS
FRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPPVPPKRVDLAKSKRKNFARWV
ELACDGYDDAVESVLETTGKPRKIQDFFQLLEALQDAGHAIHADGKDSDTLDSQAADLAD
ARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQLIDLDDQDDAWHAVLVKAEYHD
EFLALSQTLGLRTRKPQQAYLD
Download sequence
Identical sequences A1WEJ3
391735.Veis_0259 WP_011808069.1.29080 gi|121607261|ref|YP_995068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]